{"version":3,"file":"bundle.js","sources":["../../node_modules/svelte/internal/index.mjs","../../node_modules/svelte/store/index.mjs","../../node_modules/regexparam/dist/regexparam.mjs","../../node_modules/svelte-spa-router/Router.svelte","../../node_modules/smelte/src/components/Icon/Icon.svelte","../../node_modules/smelte/src/utils/classes.js","../../node_modules/smelte/src/components/Ripple/ripple.js","../../node_modules/smelte/src/components/Button/Button.svelte","../../node_modules/smelte/src/components/Card/Card.svelte","../../node_modules/svelte/easing/index.mjs","../../node_modules/svelte/transition/index.mjs","../../node_modules/smelte/src/components/Util/Scrim.svelte","../../node_modules/smelte/src/components/Util/index.js","../../node_modules/smelte/src/components/Dialog/Dialog.svelte","../../node_modules/svelte-waypoint/src/Waypoint.svelte","../../node_modules/smelte/src/components/Image/Image.svelte","../../node_modules/smelte/src/components/List/ListItem.svelte","../../node_modules/smelte/src/components/List/List.svelte","../../node_modules/smelte/src/components/TextField/Label.svelte","../../node_modules/smelte/src/components/TextField/Hint.svelte","../../node_modules/smelte/src/components/TextField/Underline.svelte","../../node_modules/smelte/src/components/TextField/TextField.svelte","../../node_modules/smelte/src/components/Menu/Menu.svelte","../../node_modules/smelte/src/components/Checkbox/Label.svelte","../../node_modules/smelte/src/components/Ripple/Ripple.svelte","../../node_modules/smelte/src/components/Checkbox/Checkbox.svelte","../../node_modules/smelte/src/utils/hide-list-action.js","../../node_modules/smelte/src/components/Select/Select.svelte","../../node_modules/smelte/src/components/ProgressCircular/ProgressCircular.svelte","../../node_modules/smelte/src/components/Snackbar/Snackbar.svelte","../../node_modules/smelte/src/components/Switch/Switch.svelte","../../node_modules/smelte/src/components/DatePicker/util.js","../../node_modules/smelte/src/components/DatePicker/Picker.svelte","../../src/store.js","../../node_modules/axios/lib/helpers/bind.js","../../node_modules/axios/lib/utils.js","../../node_modules/axios/lib/helpers/buildURL.js","../../node_modules/axios/lib/core/InterceptorManager.js","../../node_modules/axios/lib/core/transformData.js","../../node_modules/axios/lib/cancel/isCancel.js","../../node_modules/axios/lib/helpers/normalizeHeaderName.js","../../node_modules/axios/lib/core/enhanceError.js","../../node_modules/axios/lib/core/createError.js","../../node_modules/axios/lib/core/settle.js","../../node_modules/axios/lib/helpers/isAbsoluteURL.js","../../node_modules/axios/lib/helpers/combineURLs.js","../../node_modules/axios/lib/core/buildFullPath.js","../../node_modules/axios/lib/helpers/parseHeaders.js","../../node_modules/axios/lib/helpers/isURLSameOrigin.js","../../node_modules/axios/lib/helpers/cookies.js","../../node_modules/axios/lib/adapters/xhr.js","../../node_modules/axios/lib/defaults.js","../../node_modules/axios/lib/core/dispatchRequest.js","../../node_modules/axios/lib/core/mergeConfig.js","../../node_modules/axios/lib/core/Axios.js","../../node_modules/axios/lib/cancel/Cancel.js","../../node_modules/axios/lib/cancel/CancelToken.js","../../node_modules/axios/lib/helpers/spread.js","../../node_modules/axios/lib/axios.js","../../node_modules/axios/index.js","../../src/utils.js","../../src/api/api.js","../../node_modules/tiny-cookie/es/util.js","../../node_modules/tiny-cookie/es/index.js","../../src/roles.js","../../src/image-base64.js","../../src/components/Nav.svelte","../../src/components/BoxCard.svelte","../../src/components/ListItem.svelte","../../src/components/Home/applicationUtil.js","../../src/components/Home/Apps.svelte","../../src/components/LazyImage.svelte","../../src/components/SearchInput.svelte","../../src/tracking.js","../../src/components/Home/Support.svelte","../../src/components/Home/OperationSupport.svelte","../../src/routes/Home.svelte","../../src/components/Footer.svelte","../../node_modules/leaflet/dist/leaflet-src.js","../../node_modules/leaflet.markercluster/dist/leaflet.markercluster-src.js","../../src/components/DataTable/sort.js","../../src/components/DataTable/Header.svelte","../../node_modules/fa-svelte/src/Icon.svelte","../../src/components/DataTable/InfiniteScroll.svelte","../../node_modules/@fortawesome/free-solid-svg-icons/index.es.js","../../src/components/ComboBox.svelte","../../src/components/DataTable/DataTable.svelte","../../src/components/InstallBase/utils.js","../../src/components/InstallBase/RedButton.svelte","../../src/components/InstallBase/EditForm/ProjectData.svelte","../../src/components/InstallBase/api.js","../../node_modules/@fortawesome/free-regular-svg-icons/index.es.js","../../src/components/InstallBase/EditForm/EditForm.svelte","../../src/components/InstallBase/urlQuery.js","../../src/components/CityCombo.svelte","../../src/components/ValueCombo.svelte","../../src/components/InstallBase/DatePicker.svelte","../../src/components/InstallBase/FiltersInput.svelte","../../src/components/ConditionMonitoring/CheckboxGroup.svelte","../../src/components/InstallBase/FiltersSelectable.svelte","../../src/components/InstallBase/FilterElement.svelte","../../src/components/InstallBase/FiltersView.svelte","../../src/components/InstallBase/FiltersComp.svelte","../../src/components/InstallBase/BlueButton.svelte","../../src/components/InstallBase/ConfirmationPopup.svelte","../../src/components/InstallBase/InstalledBaseView.svelte","../../src/components/InstallBase/Machines.svelte","../../src/components/InstallBase/Projects.svelte","../../src/components/ConditionMonitoring/api.js","../../src/components/ConditionMonitoring/utils.js","../../src/components/ConditionMonitoring/store.js","../../src/components/ConditionMonitoring/Home.svelte","../../src/components/ConditionMonitoring/ParametersView.svelte","../../src/components/ConditionMonitoring/Parameter.svelte","../../src/components/ConditionMonitoring/Protocol.svelte","../../src/components/SpareParts/api.js","../../src/components/SpareParts/Cart.svelte","../../src/components/SpareParts/AddToCart.svelte","../../src/components/SpareParts/DetailsList.svelte","../../src/components/SpareParts/SparePartsHome.svelte","../../src/components/SpareParts/SparePartsOverview.svelte","../../src/components/Breadcrumb.svelte","../../src/components/Uploader.svelte","../../src/routes/Settings.svelte","../../src/components/DocumentLibrary/fresh-widget.js","../../src/components/Freshdesk/SeachListItem.svelte","../../src/components/LazyImageBg.svelte","../../src/components/Freshdesk/SearchView.svelte","../../src/components/ArrowUp.svelte","../../src/components/BlockInfo.svelte","../../src/components/AlertBox.svelte","../../src/App.svelte","../../node_modules/base64-js/index.js","../../node_modules/js-sha256/src/sha256.js","../../node_modules/keycloak-js/dist/keycloak.mjs","../../src/main.js"],"sourcesContent":["function noop() { }\nconst identity = x => x;\nfunction assign(tar, src) {\n // @ts-ignore\n for (const k in src)\n tar[k] = src[k];\n return tar;\n}\nfunction is_promise(value) {\n return value && typeof value === 'object' && typeof value.then === 'function';\n}\nfunction add_location(element, file, line, column, char) {\n element.__svelte_meta = {\n loc: { file, line, column, char }\n };\n}\nfunction run(fn) {\n return fn();\n}\nfunction blank_object() {\n return Object.create(null);\n}\nfunction run_all(fns) {\n fns.forEach(run);\n}\nfunction is_function(thing) {\n return typeof thing === 'function';\n}\nfunction safe_not_equal(a, b) {\n return a != a ? b == b : a !== b || ((a && typeof a === 'object') || typeof a === 'function');\n}\nfunction not_equal(a, b) {\n return a != a ? b == b : a !== b;\n}\nfunction is_empty(obj) {\n return Object.keys(obj).length === 0;\n}\nfunction validate_store(store, name) {\n if (store != null && typeof store.subscribe !== 'function') {\n throw new Error(`'${name}' is not a store with a 'subscribe' method`);\n }\n}\nfunction subscribe(store, ...callbacks) {\n if (store == null) {\n return noop;\n }\n const unsub = store.subscribe(...callbacks);\n return unsub.unsubscribe ? () => unsub.unsubscribe() : unsub;\n}\nfunction get_store_value(store) {\n let value;\n subscribe(store, _ => value = _)();\n return value;\n}\nfunction component_subscribe(component, store, callback) {\n component.$$.on_destroy.push(subscribe(store, callback));\n}\nfunction create_slot(definition, ctx, $$scope, fn) {\n if (definition) {\n const slot_ctx = get_slot_context(definition, ctx, $$scope, fn);\n return definition[0](slot_ctx);\n }\n}\nfunction get_slot_context(definition, ctx, $$scope, fn) {\n return definition[1] && fn\n ? assign($$scope.ctx.slice(), definition[1](fn(ctx)))\n : $$scope.ctx;\n}\nfunction get_slot_changes(definition, $$scope, dirty, fn) {\n if (definition[2] && fn) {\n const lets = definition[2](fn(dirty));\n if ($$scope.dirty === undefined) {\n return lets;\n }\n if (typeof lets === 'object') {\n const merged = [];\n const len = Math.max($$scope.dirty.length, lets.length);\n for (let i = 0; i < len; i += 1) {\n merged[i] = $$scope.dirty[i] | lets[i];\n }\n return merged;\n }\n return $$scope.dirty | lets;\n }\n return $$scope.dirty;\n}\nfunction update_slot(slot, slot_definition, ctx, $$scope, dirty, get_slot_changes_fn, get_slot_context_fn) {\n const slot_changes = get_slot_changes(slot_definition, $$scope, dirty, get_slot_changes_fn);\n if (slot_changes) {\n const slot_context = get_slot_context(slot_definition, ctx, $$scope, get_slot_context_fn);\n slot.p(slot_context, slot_changes);\n }\n}\nfunction update_slot_spread(slot, slot_definition, ctx, $$scope, dirty, get_slot_changes_fn, get_slot_spread_changes_fn, get_slot_context_fn) {\n const slot_changes = get_slot_spread_changes_fn(dirty) | get_slot_changes(slot_definition, $$scope, dirty, get_slot_changes_fn);\n if (slot_changes) {\n const slot_context = get_slot_context(slot_definition, ctx, $$scope, get_slot_context_fn);\n slot.p(slot_context, slot_changes);\n }\n}\nfunction exclude_internal_props(props) {\n const result = {};\n for (const k in props)\n if (k[0] !== '$')\n result[k] = props[k];\n return result;\n}\nfunction compute_rest_props(props, keys) {\n const rest = {};\n keys = new Set(keys);\n for (const k in props)\n if (!keys.has(k) && k[0] !== '$')\n rest[k] = props[k];\n return rest;\n}\nfunction compute_slots(slots) {\n const result = {};\n for (const key in slots) {\n result[key] = true;\n }\n return result;\n}\nfunction once(fn) {\n let ran = false;\n return function (...args) {\n if (ran)\n return;\n ran = true;\n fn.call(this, ...args);\n };\n}\nfunction null_to_empty(value) {\n return value == null ? '' : value;\n}\nfunction set_store_value(store, ret, value = ret) {\n store.set(value);\n return ret;\n}\nconst has_prop = (obj, prop) => Object.prototype.hasOwnProperty.call(obj, prop);\nfunction action_destroyer(action_result) {\n return action_result && is_function(action_result.destroy) ? action_result.destroy : noop;\n}\n\nconst is_client = typeof window !== 'undefined';\nlet now = is_client\n ? () => window.performance.now()\n : () => Date.now();\nlet raf = is_client ? cb => requestAnimationFrame(cb) : noop;\n// used internally for testing\nfunction set_now(fn) {\n now = fn;\n}\nfunction set_raf(fn) {\n raf = fn;\n}\n\nconst tasks = new Set();\nfunction run_tasks(now) {\n tasks.forEach(task => {\n if (!task.c(now)) {\n tasks.delete(task);\n task.f();\n }\n });\n if (tasks.size !== 0)\n raf(run_tasks);\n}\n/**\n * For testing purposes only!\n */\nfunction clear_loops() {\n tasks.clear();\n}\n/**\n * Creates a new task that runs on each raf frame\n * until it returns a falsy value or is aborted\n */\nfunction loop(callback) {\n let task;\n if (tasks.size === 0)\n raf(run_tasks);\n return {\n promise: new Promise(fulfill => {\n tasks.add(task = { c: callback, f: fulfill });\n }),\n abort() {\n tasks.delete(task);\n }\n };\n}\n\nfunction append(target, node) {\n target.appendChild(node);\n}\nfunction insert(target, node, anchor) {\n target.insertBefore(node, anchor || null);\n}\nfunction detach(node) {\n node.parentNode.removeChild(node);\n}\nfunction destroy_each(iterations, detaching) {\n for (let i = 0; i < iterations.length; i += 1) {\n if (iterations[i])\n iterations[i].d(detaching);\n }\n}\nfunction element(name) {\n return document.createElement(name);\n}\nfunction element_is(name, is) {\n return document.createElement(name, { is });\n}\nfunction object_without_properties(obj, exclude) {\n const target = {};\n for (const k in obj) {\n if (has_prop(obj, k)\n // @ts-ignore\n && exclude.indexOf(k) === -1) {\n // @ts-ignore\n target[k] = obj[k];\n }\n }\n return target;\n}\nfunction svg_element(name) {\n return document.createElementNS('http://www.w3.org/2000/svg', name);\n}\nfunction text(data) {\n return document.createTextNode(data);\n}\nfunction space() {\n return text(' ');\n}\nfunction empty() {\n return text('');\n}\nfunction listen(node, event, handler, options) {\n node.addEventListener(event, handler, options);\n return () => node.removeEventListener(event, handler, options);\n}\nfunction prevent_default(fn) {\n return function (event) {\n event.preventDefault();\n // @ts-ignore\n return fn.call(this, event);\n };\n}\nfunction stop_propagation(fn) {\n return function (event) {\n event.stopPropagation();\n // @ts-ignore\n return fn.call(this, event);\n };\n}\nfunction self(fn) {\n return function (event) {\n // @ts-ignore\n if (event.target === this)\n fn.call(this, event);\n };\n}\nfunction attr(node, attribute, value) {\n if (value == null)\n node.removeAttribute(attribute);\n else if (node.getAttribute(attribute) !== value)\n node.setAttribute(attribute, value);\n}\nfunction set_attributes(node, attributes) {\n // @ts-ignore\n const descriptors = Object.getOwnPropertyDescriptors(node.__proto__);\n for (const key in attributes) {\n if (attributes[key] == null) {\n node.removeAttribute(key);\n }\n else if (key === 'style') {\n node.style.cssText = attributes[key];\n }\n else if (key === '__value') {\n node.value = node[key] = attributes[key];\n }\n else if (descriptors[key] && descriptors[key].set) {\n node[key] = attributes[key];\n }\n else {\n attr(node, key, attributes[key]);\n }\n }\n}\nfunction set_svg_attributes(node, attributes) {\n for (const key in attributes) {\n attr(node, key, attributes[key]);\n }\n}\nfunction set_custom_element_data(node, prop, value) {\n if (prop in node) {\n node[prop] = value;\n }\n else {\n attr(node, prop, value);\n }\n}\nfunction xlink_attr(node, attribute, value) {\n node.setAttributeNS('http://www.w3.org/1999/xlink', attribute, value);\n}\nfunction get_binding_group_value(group, __value, checked) {\n const value = new Set();\n for (let i = 0; i < group.length; i += 1) {\n if (group[i].checked)\n value.add(group[i].__value);\n }\n if (!checked) {\n value.delete(__value);\n }\n return Array.from(value);\n}\nfunction to_number(value) {\n return value === '' ? null : +value;\n}\nfunction time_ranges_to_array(ranges) {\n const array = [];\n for (let i = 0; i < ranges.length; i += 1) {\n array.push({ start: ranges.start(i), end: ranges.end(i) });\n }\n return array;\n}\nfunction children(element) {\n return Array.from(element.childNodes);\n}\nfunction claim_element(nodes, name, attributes, svg) {\n for (let i = 0; i < nodes.length; i += 1) {\n const node = nodes[i];\n if (node.nodeName === name) {\n let j = 0;\n const remove = [];\n while (j < node.attributes.length) {\n const attribute = node.attributes[j++];\n if (!attributes[attribute.name]) {\n remove.push(attribute.name);\n }\n }\n for (let k = 0; k < remove.length; k++) {\n node.removeAttribute(remove[k]);\n }\n return nodes.splice(i, 1)[0];\n }\n }\n return svg ? svg_element(name) : element(name);\n}\nfunction claim_text(nodes, data) {\n for (let i = 0; i < nodes.length; i += 1) {\n const node = nodes[i];\n if (node.nodeType === 3) {\n node.data = '' + data;\n return nodes.splice(i, 1)[0];\n }\n }\n return text(data);\n}\nfunction claim_space(nodes) {\n return claim_text(nodes, ' ');\n}\nfunction set_data(text, data) {\n data = '' + data;\n if (text.wholeText !== data)\n text.data = data;\n}\nfunction set_input_value(input, value) {\n input.value = value == null ? '' : value;\n}\nfunction set_input_type(input, type) {\n try {\n input.type = type;\n }\n catch (e) {\n // do nothing\n }\n}\nfunction set_style(node, key, value, important) {\n node.style.setProperty(key, value, important ? 'important' : '');\n}\nfunction select_option(select, value) {\n for (let i = 0; i < select.options.length; i += 1) {\n const option = select.options[i];\n if (option.__value === value) {\n option.selected = true;\n return;\n }\n }\n}\nfunction select_options(select, value) {\n for (let i = 0; i < select.options.length; i += 1) {\n const option = select.options[i];\n option.selected = ~value.indexOf(option.__value);\n }\n}\nfunction select_value(select) {\n const selected_option = select.querySelector(':checked') || select.options[0];\n return selected_option && selected_option.__value;\n}\nfunction select_multiple_value(select) {\n return [].map.call(select.querySelectorAll(':checked'), option => option.__value);\n}\n// unfortunately this can't be a constant as that wouldn't be tree-shakeable\n// so we cache the result instead\nlet crossorigin;\nfunction is_crossorigin() {\n if (crossorigin === undefined) {\n crossorigin = false;\n try {\n if (typeof window !== 'undefined' && window.parent) {\n void window.parent.document;\n }\n }\n catch (error) {\n crossorigin = true;\n }\n }\n return crossorigin;\n}\nfunction add_resize_listener(node, fn) {\n const computed_style = getComputedStyle(node);\n if (computed_style.position === 'static') {\n node.style.position = 'relative';\n }\n const iframe = element('iframe');\n iframe.setAttribute('style', 'display: block; position: absolute; top: 0; left: 0; width: 100%; height: 100%; ' +\n 'overflow: hidden; border: 0; opacity: 0; pointer-events: none; z-index: -1;');\n iframe.setAttribute('aria-hidden', 'true');\n iframe.tabIndex = -1;\n const crossorigin = is_crossorigin();\n let unsubscribe;\n if (crossorigin) {\n iframe.src = \"data:text/html,\";\n unsubscribe = listen(window, 'message', (event) => {\n if (event.source === iframe.contentWindow)\n fn();\n });\n }\n else {\n iframe.src = 'about:blank';\n iframe.onload = () => {\n unsubscribe = listen(iframe.contentWindow, 'resize', fn);\n };\n }\n append(node, iframe);\n return () => {\n if (crossorigin) {\n unsubscribe();\n }\n else if (unsubscribe && iframe.contentWindow) {\n unsubscribe();\n }\n detach(iframe);\n };\n}\nfunction toggle_class(element, name, toggle) {\n element.classList[toggle ? 'add' : 'remove'](name);\n}\nfunction custom_event(type, detail) {\n const e = document.createEvent('CustomEvent');\n e.initCustomEvent(type, false, false, detail);\n return e;\n}\nfunction query_selector_all(selector, parent = document.body) {\n return Array.from(parent.querySelectorAll(selector));\n}\nclass HtmlTag {\n constructor(anchor = null) {\n this.a = anchor;\n this.e = this.n = null;\n }\n m(html, target, anchor = null) {\n if (!this.e) {\n this.e = element(target.nodeName);\n this.t = target;\n this.h(html);\n }\n this.i(anchor);\n }\n h(html) {\n this.e.innerHTML = html;\n this.n = Array.from(this.e.childNodes);\n }\n i(anchor) {\n for (let i = 0; i < this.n.length; i += 1) {\n insert(this.t, this.n[i], anchor);\n }\n }\n p(html) {\n this.d();\n this.h(html);\n this.i(this.a);\n }\n d() {\n this.n.forEach(detach);\n }\n}\nfunction attribute_to_object(attributes) {\n const result = {};\n for (const attribute of attributes) {\n result[attribute.name] = attribute.value;\n }\n return result;\n}\nfunction get_custom_elements_slots(element) {\n const result = {};\n element.childNodes.forEach((node) => {\n result[node.slot || 'default'] = true;\n });\n return result;\n}\n\nconst active_docs = new Set();\nlet active = 0;\n// https://github.com/darkskyapp/string-hash/blob/master/index.js\nfunction hash(str) {\n let hash = 5381;\n let i = str.length;\n while (i--)\n hash = ((hash << 5) - hash) ^ str.charCodeAt(i);\n return hash >>> 0;\n}\nfunction create_rule(node, a, b, duration, delay, ease, fn, uid = 0) {\n const step = 16.666 / duration;\n let keyframes = '{\\n';\n for (let p = 0; p <= 1; p += step) {\n const t = a + (b - a) * ease(p);\n keyframes += p * 100 + `%{${fn(t, 1 - t)}}\\n`;\n }\n const rule = keyframes + `100% {${fn(b, 1 - b)}}\\n}`;\n const name = `__svelte_${hash(rule)}_${uid}`;\n const doc = node.ownerDocument;\n active_docs.add(doc);\n const stylesheet = doc.__svelte_stylesheet || (doc.__svelte_stylesheet = doc.head.appendChild(element('style')).sheet);\n const current_rules = doc.__svelte_rules || (doc.__svelte_rules = {});\n if (!current_rules[name]) {\n current_rules[name] = true;\n stylesheet.insertRule(`@keyframes ${name} ${rule}`, stylesheet.cssRules.length);\n }\n const animation = node.style.animation || '';\n node.style.animation = `${animation ? `${animation}, ` : ''}${name} ${duration}ms linear ${delay}ms 1 both`;\n active += 1;\n return name;\n}\nfunction delete_rule(node, name) {\n const previous = (node.style.animation || '').split(', ');\n const next = previous.filter(name\n ? anim => anim.indexOf(name) < 0 // remove specific animation\n : anim => anim.indexOf('__svelte') === -1 // remove all Svelte animations\n );\n const deleted = previous.length - next.length;\n if (deleted) {\n node.style.animation = next.join(', ');\n active -= deleted;\n if (!active)\n clear_rules();\n }\n}\nfunction clear_rules() {\n raf(() => {\n if (active)\n return;\n active_docs.forEach(doc => {\n const stylesheet = doc.__svelte_stylesheet;\n let i = stylesheet.cssRules.length;\n while (i--)\n stylesheet.deleteRule(i);\n doc.__svelte_rules = {};\n });\n active_docs.clear();\n });\n}\n\nfunction create_animation(node, from, fn, params) {\n if (!from)\n return noop;\n const to = node.getBoundingClientRect();\n if (from.left === to.left && from.right === to.right && from.top === to.top && from.bottom === to.bottom)\n return noop;\n const { delay = 0, duration = 300, easing = identity, \n // @ts-ignore todo: should this be separated from destructuring? Or start/end added to public api and documentation?\n start: start_time = now() + delay, \n // @ts-ignore todo:\n end = start_time + duration, tick = noop, css } = fn(node, { from, to }, params);\n let running = true;\n let started = false;\n let name;\n function start() {\n if (css) {\n name = create_rule(node, 0, 1, duration, delay, easing, css);\n }\n if (!delay) {\n started = true;\n }\n }\n function stop() {\n if (css)\n delete_rule(node, name);\n running = false;\n }\n loop(now => {\n if (!started && now >= start_time) {\n started = true;\n }\n if (started && now >= end) {\n tick(1, 0);\n stop();\n }\n if (!running) {\n return false;\n }\n if (started) {\n const p = now - start_time;\n const t = 0 + 1 * easing(p / duration);\n tick(t, 1 - t);\n }\n return true;\n });\n start();\n tick(0, 1);\n return stop;\n}\nfunction fix_position(node) {\n const style = getComputedStyle(node);\n if (style.position !== 'absolute' && style.position !== 'fixed') {\n const { width, height } = style;\n const a = node.getBoundingClientRect();\n node.style.position = 'absolute';\n node.style.width = width;\n node.style.height = height;\n add_transform(node, a);\n }\n}\nfunction add_transform(node, a) {\n const b = node.getBoundingClientRect();\n if (a.left !== b.left || a.top !== b.top) {\n const style = getComputedStyle(node);\n const transform = style.transform === 'none' ? '' : style.transform;\n node.style.transform = `${transform} translate(${a.left - b.left}px, ${a.top - b.top}px)`;\n }\n}\n\nlet current_component;\nfunction set_current_component(component) {\n current_component = component;\n}\nfunction get_current_component() {\n if (!current_component)\n throw new Error('Function called outside component initialization');\n return current_component;\n}\nfunction beforeUpdate(fn) {\n get_current_component().$$.before_update.push(fn);\n}\nfunction onMount(fn) {\n get_current_component().$$.on_mount.push(fn);\n}\nfunction afterUpdate(fn) {\n get_current_component().$$.after_update.push(fn);\n}\nfunction onDestroy(fn) {\n get_current_component().$$.on_destroy.push(fn);\n}\nfunction createEventDispatcher() {\n const component = get_current_component();\n return (type, detail) => {\n const callbacks = component.$$.callbacks[type];\n if (callbacks) {\n // TODO are there situations where events could be dispatched\n // in a server (non-DOM) environment?\n const event = custom_event(type, detail);\n callbacks.slice().forEach(fn => {\n fn.call(component, event);\n });\n }\n };\n}\nfunction setContext(key, context) {\n get_current_component().$$.context.set(key, context);\n}\nfunction getContext(key) {\n return get_current_component().$$.context.get(key);\n}\nfunction hasContext(key) {\n return get_current_component().$$.context.has(key);\n}\n// TODO figure out if we still want to support\n// shorthand events, or if we want to implement\n// a real bubbling mechanism\nfunction bubble(component, event) {\n const callbacks = component.$$.callbacks[event.type];\n if (callbacks) {\n callbacks.slice().forEach(fn => fn(event));\n }\n}\n\nconst dirty_components = [];\nconst intros = { enabled: false };\nconst binding_callbacks = [];\nconst render_callbacks = [];\nconst flush_callbacks = [];\nconst resolved_promise = Promise.resolve();\nlet update_scheduled = false;\nfunction schedule_update() {\n if (!update_scheduled) {\n update_scheduled = true;\n resolved_promise.then(flush);\n }\n}\nfunction tick() {\n schedule_update();\n return resolved_promise;\n}\nfunction add_render_callback(fn) {\n render_callbacks.push(fn);\n}\nfunction add_flush_callback(fn) {\n flush_callbacks.push(fn);\n}\nlet flushing = false;\nconst seen_callbacks = new Set();\nfunction flush() {\n if (flushing)\n return;\n flushing = true;\n do {\n // first, call beforeUpdate functions\n // and update components\n for (let i = 0; i < dirty_components.length; i += 1) {\n const component = dirty_components[i];\n set_current_component(component);\n update(component.$$);\n }\n set_current_component(null);\n dirty_components.length = 0;\n while (binding_callbacks.length)\n binding_callbacks.pop()();\n // then, once components are updated, call\n // afterUpdate functions. This may cause\n // subsequent updates...\n for (let i = 0; i < render_callbacks.length; i += 1) {\n const callback = render_callbacks[i];\n if (!seen_callbacks.has(callback)) {\n // ...so guard against infinite loops\n seen_callbacks.add(callback);\n callback();\n }\n }\n render_callbacks.length = 0;\n } while (dirty_components.length);\n while (flush_callbacks.length) {\n flush_callbacks.pop()();\n }\n update_scheduled = false;\n flushing = false;\n seen_callbacks.clear();\n}\nfunction update($$) {\n if ($$.fragment !== null) {\n $$.update();\n run_all($$.before_update);\n const dirty = $$.dirty;\n $$.dirty = [-1];\n $$.fragment && $$.fragment.p($$.ctx, dirty);\n $$.after_update.forEach(add_render_callback);\n }\n}\n\nlet promise;\nfunction wait() {\n if (!promise) {\n promise = Promise.resolve();\n promise.then(() => {\n promise = null;\n });\n }\n return promise;\n}\nfunction dispatch(node, direction, kind) {\n node.dispatchEvent(custom_event(`${direction ? 'intro' : 'outro'}${kind}`));\n}\nconst outroing = new Set();\nlet outros;\nfunction group_outros() {\n outros = {\n r: 0,\n c: [],\n p: outros // parent group\n };\n}\nfunction check_outros() {\n if (!outros.r) {\n run_all(outros.c);\n }\n outros = outros.p;\n}\nfunction transition_in(block, local) {\n if (block && block.i) {\n outroing.delete(block);\n block.i(local);\n }\n}\nfunction transition_out(block, local, detach, callback) {\n if (block && block.o) {\n if (outroing.has(block))\n return;\n outroing.add(block);\n outros.c.push(() => {\n outroing.delete(block);\n if (callback) {\n if (detach)\n block.d(1);\n callback();\n }\n });\n block.o(local);\n }\n}\nconst null_transition = { duration: 0 };\nfunction create_in_transition(node, fn, params) {\n let config = fn(node, params);\n let running = false;\n let animation_name;\n let task;\n let uid = 0;\n function cleanup() {\n if (animation_name)\n delete_rule(node, animation_name);\n }\n function go() {\n const { delay = 0, duration = 300, easing = identity, tick = noop, css } = config || null_transition;\n if (css)\n animation_name = create_rule(node, 0, 1, duration, delay, easing, css, uid++);\n tick(0, 1);\n const start_time = now() + delay;\n const end_time = start_time + duration;\n if (task)\n task.abort();\n running = true;\n add_render_callback(() => dispatch(node, true, 'start'));\n task = loop(now => {\n if (running) {\n if (now >= end_time) {\n tick(1, 0);\n dispatch(node, true, 'end');\n cleanup();\n return running = false;\n }\n if (now >= start_time) {\n const t = easing((now - start_time) / duration);\n tick(t, 1 - t);\n }\n }\n return running;\n });\n }\n let started = false;\n return {\n start() {\n if (started)\n return;\n delete_rule(node);\n if (is_function(config)) {\n config = config();\n wait().then(go);\n }\n else {\n go();\n }\n },\n invalidate() {\n started = false;\n },\n end() {\n if (running) {\n cleanup();\n running = false;\n }\n }\n };\n}\nfunction create_out_transition(node, fn, params) {\n let config = fn(node, params);\n let running = true;\n let animation_name;\n const group = outros;\n group.r += 1;\n function go() {\n const { delay = 0, duration = 300, easing = identity, tick = noop, css } = config || null_transition;\n if (css)\n animation_name = create_rule(node, 1, 0, duration, delay, easing, css);\n const start_time = now() + delay;\n const end_time = start_time + duration;\n add_render_callback(() => dispatch(node, false, 'start'));\n loop(now => {\n if (running) {\n if (now >= end_time) {\n tick(0, 1);\n dispatch(node, false, 'end');\n if (!--group.r) {\n // this will result in `end()` being called,\n // so we don't need to clean up here\n run_all(group.c);\n }\n return false;\n }\n if (now >= start_time) {\n const t = easing((now - start_time) / duration);\n tick(1 - t, t);\n }\n }\n return running;\n });\n }\n if (is_function(config)) {\n wait().then(() => {\n // @ts-ignore\n config = config();\n go();\n });\n }\n else {\n go();\n }\n return {\n end(reset) {\n if (reset && config.tick) {\n config.tick(1, 0);\n }\n if (running) {\n if (animation_name)\n delete_rule(node, animation_name);\n running = false;\n }\n }\n };\n}\nfunction create_bidirectional_transition(node, fn, params, intro) {\n let config = fn(node, params);\n let t = intro ? 0 : 1;\n let running_program = null;\n let pending_program = null;\n let animation_name = null;\n function clear_animation() {\n if (animation_name)\n delete_rule(node, animation_name);\n }\n function init(program, duration) {\n const d = program.b - t;\n duration *= Math.abs(d);\n return {\n a: t,\n b: program.b,\n d,\n duration,\n start: program.start,\n end: program.start + duration,\n group: program.group\n };\n }\n function go(b) {\n const { delay = 0, duration = 300, easing = identity, tick = noop, css } = config || null_transition;\n const program = {\n start: now() + delay,\n b\n };\n if (!b) {\n // @ts-ignore todo: improve typings\n program.group = outros;\n outros.r += 1;\n }\n if (running_program || pending_program) {\n pending_program = program;\n }\n else {\n // if this is an intro, and there's a delay, we need to do\n // an initial tick and/or apply CSS animation immediately\n if (css) {\n clear_animation();\n animation_name = create_rule(node, t, b, duration, delay, easing, css);\n }\n if (b)\n tick(0, 1);\n running_program = init(program, duration);\n add_render_callback(() => dispatch(node, b, 'start'));\n loop(now => {\n if (pending_program && now > pending_program.start) {\n running_program = init(pending_program, duration);\n pending_program = null;\n dispatch(node, running_program.b, 'start');\n if (css) {\n clear_animation();\n animation_name = create_rule(node, t, running_program.b, running_program.duration, 0, easing, config.css);\n }\n }\n if (running_program) {\n if (now >= running_program.end) {\n tick(t = running_program.b, 1 - t);\n dispatch(node, running_program.b, 'end');\n if (!pending_program) {\n // we're done\n if (running_program.b) {\n // intro — we can tidy up immediately\n clear_animation();\n }\n else {\n // outro — needs to be coordinated\n if (!--running_program.group.r)\n run_all(running_program.group.c);\n }\n }\n running_program = null;\n }\n else if (now >= running_program.start) {\n const p = now - running_program.start;\n t = running_program.a + running_program.d * easing(p / running_program.duration);\n tick(t, 1 - t);\n }\n }\n return !!(running_program || pending_program);\n });\n }\n }\n return {\n run(b) {\n if (is_function(config)) {\n wait().then(() => {\n // @ts-ignore\n config = config();\n go(b);\n });\n }\n else {\n go(b);\n }\n },\n end() {\n clear_animation();\n running_program = pending_program = null;\n }\n };\n}\n\nfunction handle_promise(promise, info) {\n const token = info.token = {};\n function update(type, index, key, value) {\n if (info.token !== token)\n return;\n info.resolved = value;\n let child_ctx = info.ctx;\n if (key !== undefined) {\n child_ctx = child_ctx.slice();\n child_ctx[key] = value;\n }\n const block = type && (info.current = type)(child_ctx);\n let needs_flush = false;\n if (info.block) {\n if (info.blocks) {\n info.blocks.forEach((block, i) => {\n if (i !== index && block) {\n group_outros();\n transition_out(block, 1, 1, () => {\n if (info.blocks[i] === block) {\n info.blocks[i] = null;\n }\n });\n check_outros();\n }\n });\n }\n else {\n info.block.d(1);\n }\n block.c();\n transition_in(block, 1);\n block.m(info.mount(), info.anchor);\n needs_flush = true;\n }\n info.block = block;\n if (info.blocks)\n info.blocks[index] = block;\n if (needs_flush) {\n flush();\n }\n }\n if (is_promise(promise)) {\n const current_component = get_current_component();\n promise.then(value => {\n set_current_component(current_component);\n update(info.then, 1, info.value, value);\n set_current_component(null);\n }, error => {\n set_current_component(current_component);\n update(info.catch, 2, info.error, error);\n set_current_component(null);\n if (!info.hasCatch) {\n throw error;\n }\n });\n // if we previously had a then/catch block, destroy it\n if (info.current !== info.pending) {\n update(info.pending, 0);\n return true;\n }\n }\n else {\n if (info.current !== info.then) {\n update(info.then, 1, info.value, promise);\n return true;\n }\n info.resolved = promise;\n }\n}\n\nconst globals = (typeof window !== 'undefined'\n ? window\n : typeof globalThis !== 'undefined'\n ? globalThis\n : global);\n\nfunction destroy_block(block, lookup) {\n block.d(1);\n lookup.delete(block.key);\n}\nfunction outro_and_destroy_block(block, lookup) {\n transition_out(block, 1, 1, () => {\n lookup.delete(block.key);\n });\n}\nfunction fix_and_destroy_block(block, lookup) {\n block.f();\n destroy_block(block, lookup);\n}\nfunction fix_and_outro_and_destroy_block(block, lookup) {\n block.f();\n outro_and_destroy_block(block, lookup);\n}\nfunction update_keyed_each(old_blocks, dirty, get_key, dynamic, ctx, list, lookup, node, destroy, create_each_block, next, get_context) {\n let o = old_blocks.length;\n let n = list.length;\n let i = o;\n const old_indexes = {};\n while (i--)\n old_indexes[old_blocks[i].key] = i;\n const new_blocks = [];\n const new_lookup = new Map();\n const deltas = new Map();\n i = n;\n while (i--) {\n const child_ctx = get_context(ctx, list, i);\n const key = get_key(child_ctx);\n let block = lookup.get(key);\n if (!block) {\n block = create_each_block(key, child_ctx);\n block.c();\n }\n else if (dynamic) {\n block.p(child_ctx, dirty);\n }\n new_lookup.set(key, new_blocks[i] = block);\n if (key in old_indexes)\n deltas.set(key, Math.abs(i - old_indexes[key]));\n }\n const will_move = new Set();\n const did_move = new Set();\n function insert(block) {\n transition_in(block, 1);\n block.m(node, next);\n lookup.set(block.key, block);\n next = block.first;\n n--;\n }\n while (o && n) {\n const new_block = new_blocks[n - 1];\n const old_block = old_blocks[o - 1];\n const new_key = new_block.key;\n const old_key = old_block.key;\n if (new_block === old_block) {\n // do nothing\n next = new_block.first;\n o--;\n n--;\n }\n else if (!new_lookup.has(old_key)) {\n // remove old block\n destroy(old_block, lookup);\n o--;\n }\n else if (!lookup.has(new_key) || will_move.has(new_key)) {\n insert(new_block);\n }\n else if (did_move.has(old_key)) {\n o--;\n }\n else if (deltas.get(new_key) > deltas.get(old_key)) {\n did_move.add(new_key);\n insert(new_block);\n }\n else {\n will_move.add(old_key);\n o--;\n }\n }\n while (o--) {\n const old_block = old_blocks[o];\n if (!new_lookup.has(old_block.key))\n destroy(old_block, lookup);\n }\n while (n)\n insert(new_blocks[n - 1]);\n return new_blocks;\n}\nfunction validate_each_keys(ctx, list, get_context, get_key) {\n const keys = new Set();\n for (let i = 0; i < list.length; i++) {\n const key = get_key(get_context(ctx, list, i));\n if (keys.has(key)) {\n throw new Error('Cannot have duplicate keys in a keyed each');\n }\n keys.add(key);\n }\n}\n\nfunction get_spread_update(levels, updates) {\n const update = {};\n const to_null_out = {};\n const accounted_for = { $$scope: 1 };\n let i = levels.length;\n while (i--) {\n const o = levels[i];\n const n = updates[i];\n if (n) {\n for (const key in o) {\n if (!(key in n))\n to_null_out[key] = 1;\n }\n for (const key in n) {\n if (!accounted_for[key]) {\n update[key] = n[key];\n accounted_for[key] = 1;\n }\n }\n levels[i] = n;\n }\n else {\n for (const key in o) {\n accounted_for[key] = 1;\n }\n }\n }\n for (const key in to_null_out) {\n if (!(key in update))\n update[key] = undefined;\n }\n return update;\n}\nfunction get_spread_object(spread_props) {\n return typeof spread_props === 'object' && spread_props !== null ? spread_props : {};\n}\n\n// source: https://html.spec.whatwg.org/multipage/indices.html\nconst boolean_attributes = new Set([\n 'allowfullscreen',\n 'allowpaymentrequest',\n 'async',\n 'autofocus',\n 'autoplay',\n 'checked',\n 'controls',\n 'default',\n 'defer',\n 'disabled',\n 'formnovalidate',\n 'hidden',\n 'ismap',\n 'loop',\n 'multiple',\n 'muted',\n 'nomodule',\n 'novalidate',\n 'open',\n 'playsinline',\n 'readonly',\n 'required',\n 'reversed',\n 'selected'\n]);\n\nconst invalid_attribute_name_character = /[\\s'\">/=\\u{FDD0}-\\u{FDEF}\\u{FFFE}\\u{FFFF}\\u{1FFFE}\\u{1FFFF}\\u{2FFFE}\\u{2FFFF}\\u{3FFFE}\\u{3FFFF}\\u{4FFFE}\\u{4FFFF}\\u{5FFFE}\\u{5FFFF}\\u{6FFFE}\\u{6FFFF}\\u{7FFFE}\\u{7FFFF}\\u{8FFFE}\\u{8FFFF}\\u{9FFFE}\\u{9FFFF}\\u{AFFFE}\\u{AFFFF}\\u{BFFFE}\\u{BFFFF}\\u{CFFFE}\\u{CFFFF}\\u{DFFFE}\\u{DFFFF}\\u{EFFFE}\\u{EFFFF}\\u{FFFFE}\\u{FFFFF}\\u{10FFFE}\\u{10FFFF}]/u;\n// https://html.spec.whatwg.org/multipage/syntax.html#attributes-2\n// https://infra.spec.whatwg.org/#noncharacter\nfunction spread(args, classes_to_add) {\n const attributes = Object.assign({}, ...args);\n if (classes_to_add) {\n if (attributes.class == null) {\n attributes.class = classes_to_add;\n }\n else {\n attributes.class += ' ' + classes_to_add;\n }\n }\n let str = '';\n Object.keys(attributes).forEach(name => {\n if (invalid_attribute_name_character.test(name))\n return;\n const value = attributes[name];\n if (value === true)\n str += ' ' + name;\n else if (boolean_attributes.has(name.toLowerCase())) {\n if (value)\n str += ' ' + name;\n }\n else if (value != null) {\n str += ` ${name}=\"${String(value).replace(/\"/g, '"').replace(/'/g, ''')}\"`;\n }\n });\n return str;\n}\nconst escaped = {\n '\"': '"',\n \"'\": ''',\n '&': '&',\n '<': '<',\n '>': '>'\n};\nfunction escape(html) {\n return String(html).replace(/[\"'&<>]/g, match => escaped[match]);\n}\nfunction each(items, fn) {\n let str = '';\n for (let i = 0; i < items.length; i += 1) {\n str += fn(items[i], i);\n }\n return str;\n}\nconst missing_component = {\n $$render: () => ''\n};\nfunction validate_component(component, name) {\n if (!component || !component.$$render) {\n if (name === 'svelte:component')\n name += ' this={...}';\n throw new Error(`<${name}> is not a valid SSR component. You may need to review your build config to ensure that dependencies are compiled, rather than imported as pre-compiled modules`);\n }\n return component;\n}\nfunction debug(file, line, column, values) {\n console.log(`{@debug} ${file ? file + ' ' : ''}(${line}:${column})`); // eslint-disable-line no-console\n console.log(values); // eslint-disable-line no-console\n return '';\n}\nlet on_destroy;\nfunction create_ssr_component(fn) {\n function $$render(result, props, bindings, slots) {\n const parent_component = current_component;\n const $$ = {\n on_destroy,\n context: new Map(parent_component ? parent_component.$$.context : []),\n // these will be immediately discarded\n on_mount: [],\n before_update: [],\n after_update: [],\n callbacks: blank_object()\n };\n set_current_component({ $$ });\n const html = fn(result, props, bindings, slots);\n set_current_component(parent_component);\n return html;\n }\n return {\n render: (props = {}, options = {}) => {\n on_destroy = [];\n const result = { title: '', head: '', css: new Set() };\n const html = $$render(result, props, {}, options);\n run_all(on_destroy);\n return {\n html,\n css: {\n code: Array.from(result.css).map(css => css.code).join('\\n'),\n map: null // TODO\n },\n head: result.title + result.head\n };\n },\n $$render\n };\n}\nfunction add_attribute(name, value, boolean) {\n if (value == null || (boolean && !value))\n return '';\n return ` ${name}${value === true ? '' : `=${typeof value === 'string' ? JSON.stringify(escape(value)) : `\"${value}\"`}`}`;\n}\nfunction add_classes(classes) {\n return classes ? ` class=\"${classes}\"` : '';\n}\n\nfunction bind(component, name, callback) {\n const index = component.$$.props[name];\n if (index !== undefined) {\n component.$$.bound[index] = callback;\n callback(component.$$.ctx[index]);\n }\n}\nfunction create_component(block) {\n block && block.c();\n}\nfunction claim_component(block, parent_nodes) {\n block && block.l(parent_nodes);\n}\nfunction mount_component(component, target, anchor, customElement) {\n const { fragment, on_mount, on_destroy, after_update } = component.$$;\n fragment && fragment.m(target, anchor);\n if (!customElement) {\n // onMount happens before the initial afterUpdate\n add_render_callback(() => {\n const new_on_destroy = on_mount.map(run).filter(is_function);\n if (on_destroy) {\n on_destroy.push(...new_on_destroy);\n }\n else {\n // Edge case - component was destroyed immediately,\n // most likely as a result of a binding initialising\n run_all(new_on_destroy);\n }\n component.$$.on_mount = [];\n });\n }\n after_update.forEach(add_render_callback);\n}\nfunction destroy_component(component, detaching) {\n const $$ = component.$$;\n if ($$.fragment !== null) {\n run_all($$.on_destroy);\n $$.fragment && $$.fragment.d(detaching);\n // TODO null out other refs, including component.$$ (but need to\n // preserve final state?)\n $$.on_destroy = $$.fragment = null;\n $$.ctx = [];\n }\n}\nfunction make_dirty(component, i) {\n if (component.$$.dirty[0] === -1) {\n dirty_components.push(component);\n schedule_update();\n component.$$.dirty.fill(0);\n }\n component.$$.dirty[(i / 31) | 0] |= (1 << (i % 31));\n}\nfunction init(component, options, instance, create_fragment, not_equal, props, dirty = [-1]) {\n const parent_component = current_component;\n set_current_component(component);\n const $$ = component.$$ = {\n fragment: null,\n ctx: null,\n // state\n props,\n update: noop,\n not_equal,\n bound: blank_object(),\n // lifecycle\n on_mount: [],\n on_destroy: [],\n on_disconnect: [],\n before_update: [],\n after_update: [],\n context: new Map(parent_component ? parent_component.$$.context : []),\n // everything else\n callbacks: blank_object(),\n dirty,\n skip_bound: false\n };\n let ready = false;\n $$.ctx = instance\n ? instance(component, options.props || {}, (i, ret, ...rest) => {\n const value = rest.length ? rest[0] : ret;\n if ($$.ctx && not_equal($$.ctx[i], $$.ctx[i] = value)) {\n if (!$$.skip_bound && $$.bound[i])\n $$.bound[i](value);\n if (ready)\n make_dirty(component, i);\n }\n return ret;\n })\n : [];\n $$.update();\n ready = true;\n run_all($$.before_update);\n // `false` as a special case of no DOM component\n $$.fragment = create_fragment ? create_fragment($$.ctx) : false;\n if (options.target) {\n if (options.hydrate) {\n const nodes = children(options.target);\n // eslint-disable-next-line @typescript-eslint/no-non-null-assertion\n $$.fragment && $$.fragment.l(nodes);\n nodes.forEach(detach);\n }\n else {\n // eslint-disable-next-line @typescript-eslint/no-non-null-assertion\n $$.fragment && $$.fragment.c();\n }\n if (options.intro)\n transition_in(component.$$.fragment);\n mount_component(component, options.target, options.anchor, options.customElement);\n flush();\n }\n set_current_component(parent_component);\n}\nlet SvelteElement;\nif (typeof HTMLElement === 'function') {\n SvelteElement = class extends HTMLElement {\n constructor() {\n super();\n this.attachShadow({ mode: 'open' });\n }\n connectedCallback() {\n const { on_mount } = this.$$;\n this.$$.on_disconnect = on_mount.map(run).filter(is_function);\n // @ts-ignore todo: improve typings\n for (const key in this.$$.slotted) {\n // @ts-ignore todo: improve typings\n this.appendChild(this.$$.slotted[key]);\n }\n }\n attributeChangedCallback(attr, _oldValue, newValue) {\n this[attr] = newValue;\n }\n disconnectedCallback() {\n run_all(this.$$.on_disconnect);\n }\n $destroy() {\n destroy_component(this, 1);\n this.$destroy = noop;\n }\n $on(type, callback) {\n // TODO should this delegate to addEventListener?\n const callbacks = (this.$$.callbacks[type] || (this.$$.callbacks[type] = []));\n callbacks.push(callback);\n return () => {\n const index = callbacks.indexOf(callback);\n if (index !== -1)\n callbacks.splice(index, 1);\n };\n }\n $set($$props) {\n if (this.$$set && !is_empty($$props)) {\n this.$$.skip_bound = true;\n this.$$set($$props);\n this.$$.skip_bound = false;\n }\n }\n };\n}\n/**\n * Base class for Svelte components. Used when dev=false.\n */\nclass SvelteComponent {\n $destroy() {\n destroy_component(this, 1);\n this.$destroy = noop;\n }\n $on(type, callback) {\n const callbacks = (this.$$.callbacks[type] || (this.$$.callbacks[type] = []));\n callbacks.push(callback);\n return () => {\n const index = callbacks.indexOf(callback);\n if (index !== -1)\n callbacks.splice(index, 1);\n };\n }\n $set($$props) {\n if (this.$$set && !is_empty($$props)) {\n this.$$.skip_bound = true;\n this.$$set($$props);\n this.$$.skip_bound = false;\n }\n }\n}\n\nfunction dispatch_dev(type, detail) {\n document.dispatchEvent(custom_event(type, Object.assign({ version: '3.35.0' }, detail)));\n}\nfunction append_dev(target, node) {\n dispatch_dev('SvelteDOMInsert', { target, node });\n append(target, node);\n}\nfunction insert_dev(target, node, anchor) {\n dispatch_dev('SvelteDOMInsert', { target, node, anchor });\n insert(target, node, anchor);\n}\nfunction detach_dev(node) {\n dispatch_dev('SvelteDOMRemove', { node });\n detach(node);\n}\nfunction detach_between_dev(before, after) {\n while (before.nextSibling && before.nextSibling !== after) {\n detach_dev(before.nextSibling);\n }\n}\nfunction detach_before_dev(after) {\n while (after.previousSibling) {\n detach_dev(after.previousSibling);\n }\n}\nfunction detach_after_dev(before) {\n while (before.nextSibling) {\n detach_dev(before.nextSibling);\n }\n}\nfunction listen_dev(node, event, handler, options, has_prevent_default, has_stop_propagation) {\n const modifiers = options === true ? ['capture'] : options ? Array.from(Object.keys(options)) : [];\n if (has_prevent_default)\n modifiers.push('preventDefault');\n if (has_stop_propagation)\n modifiers.push('stopPropagation');\n dispatch_dev('SvelteDOMAddEventListener', { node, event, handler, modifiers });\n const dispose = listen(node, event, handler, options);\n return () => {\n dispatch_dev('SvelteDOMRemoveEventListener', { node, event, handler, modifiers });\n dispose();\n };\n}\nfunction attr_dev(node, attribute, value) {\n attr(node, attribute, value);\n if (value == null)\n dispatch_dev('SvelteDOMRemoveAttribute', { node, attribute });\n else\n dispatch_dev('SvelteDOMSetAttribute', { node, attribute, value });\n}\nfunction prop_dev(node, property, value) {\n node[property] = value;\n dispatch_dev('SvelteDOMSetProperty', { node, property, value });\n}\nfunction dataset_dev(node, property, value) {\n node.dataset[property] = value;\n dispatch_dev('SvelteDOMSetDataset', { node, property, value });\n}\nfunction set_data_dev(text, data) {\n data = '' + data;\n if (text.wholeText === data)\n return;\n dispatch_dev('SvelteDOMSetData', { node: text, data });\n text.data = data;\n}\nfunction validate_each_argument(arg) {\n if (typeof arg !== 'string' && !(arg && typeof arg === 'object' && 'length' in arg)) {\n let msg = '{#each} only iterates over array-like objects.';\n if (typeof Symbol === 'function' && arg && Symbol.iterator in arg) {\n msg += ' You can use a spread to convert this iterable into an array.';\n }\n throw new Error(msg);\n }\n}\nfunction validate_slots(name, slot, keys) {\n for (const slot_key of Object.keys(slot)) {\n if (!~keys.indexOf(slot_key)) {\n console.warn(`<${name}> received an unexpected slot \"${slot_key}\".`);\n }\n }\n}\n/**\n * Base class for Svelte components with some minor dev-enhancements. Used when dev=true.\n */\nclass SvelteComponentDev extends SvelteComponent {\n constructor(options) {\n if (!options || (!options.target && !options.$$inline)) {\n throw new Error(\"'target' is a required option\");\n }\n super();\n }\n $destroy() {\n super.$destroy();\n this.$destroy = () => {\n console.warn('Component was already destroyed'); // eslint-disable-line no-console\n };\n }\n $capture_state() { }\n $inject_state() { }\n}\n/**\n * Base class to create strongly typed Svelte components.\n * This only exists for typing purposes and should be used in `.d.ts` files.\n *\n * ### Example:\n *\n * You have component library on npm called `component-library`, from which\n * you export a component called `MyComponent`. For Svelte+TypeScript users,\n * you want to provide typings. Therefore you create a `index.d.ts`:\n * ```ts\n * import { SvelteComponentTyped } from \"svelte\";\n * export class MyComponent extends SvelteComponentTyped<{foo: string}> {}\n * ```\n * Typing this makes it possible for IDEs like VS Code with the Svelte extension\n * to provide intellisense and to use the component like this in a Svelte file\n * with TypeScript:\n * ```svelte\n * \n * \n * ```\n *\n * #### Why not make this part of `SvelteComponent(Dev)`?\n * Because\n * ```ts\n * class ASubclassOfSvelteComponent extends SvelteComponent<{foo: string}> {}\n * const component: typeof SvelteComponent = ASubclassOfSvelteComponent;\n * ```\n * will throw a type error, so we need to seperate the more strictly typed class.\n */\nclass SvelteComponentTyped extends SvelteComponentDev {\n constructor(options) {\n super(options);\n }\n}\nfunction loop_guard(timeout) {\n const start = Date.now();\n return () => {\n if (Date.now() - start > timeout) {\n throw new Error('Infinite loop detected');\n }\n };\n}\n\nexport { HtmlTag, SvelteComponent, SvelteComponentDev, SvelteComponentTyped, SvelteElement, action_destroyer, add_attribute, add_classes, add_flush_callback, add_location, add_render_callback, add_resize_listener, add_transform, afterUpdate, append, append_dev, assign, attr, attr_dev, attribute_to_object, beforeUpdate, bind, binding_callbacks, blank_object, bubble, check_outros, children, claim_component, claim_element, claim_space, claim_text, clear_loops, component_subscribe, compute_rest_props, compute_slots, createEventDispatcher, create_animation, create_bidirectional_transition, create_component, create_in_transition, create_out_transition, create_slot, create_ssr_component, current_component, custom_event, dataset_dev, debug, destroy_block, destroy_component, destroy_each, detach, detach_after_dev, detach_before_dev, detach_between_dev, detach_dev, dirty_components, dispatch_dev, each, element, element_is, empty, escape, escaped, exclude_internal_props, fix_and_destroy_block, fix_and_outro_and_destroy_block, fix_position, flush, getContext, get_binding_group_value, get_current_component, get_custom_elements_slots, get_slot_changes, get_slot_context, get_spread_object, get_spread_update, get_store_value, globals, group_outros, handle_promise, hasContext, has_prop, identity, init, insert, insert_dev, intros, invalid_attribute_name_character, is_client, is_crossorigin, is_empty, is_function, is_promise, listen, listen_dev, loop, loop_guard, missing_component, mount_component, noop, not_equal, now, null_to_empty, object_without_properties, onDestroy, onMount, once, outro_and_destroy_block, prevent_default, prop_dev, query_selector_all, raf, run, run_all, safe_not_equal, schedule_update, select_multiple_value, select_option, select_options, select_value, self, setContext, set_attributes, set_current_component, set_custom_element_data, set_data, set_data_dev, set_input_type, set_input_value, set_now, set_raf, set_store_value, set_style, set_svg_attributes, space, spread, stop_propagation, subscribe, svg_element, text, tick, time_ranges_to_array, to_number, toggle_class, transition_in, transition_out, update_keyed_each, update_slot, update_slot_spread, validate_component, validate_each_argument, validate_each_keys, validate_slots, validate_store, xlink_attr };\n","import { noop, safe_not_equal, subscribe, run_all, is_function } from '../internal/index.mjs';\nexport { get_store_value as get } from '../internal/index.mjs';\n\nconst subscriber_queue = [];\n/**\n * Creates a `Readable` store that allows reading by subscription.\n * @param value initial value\n * @param {StartStopNotifier}start start and stop notifications for subscriptions\n */\nfunction readable(value, start) {\n return {\n subscribe: writable(value, start).subscribe\n };\n}\n/**\n * Create a `Writable` store that allows both updating and reading by subscription.\n * @param {*=}value initial value\n * @param {StartStopNotifier=}start start and stop notifications for subscriptions\n */\nfunction writable(value, start = noop) {\n let stop;\n const subscribers = [];\n function set(new_value) {\n if (safe_not_equal(value, new_value)) {\n value = new_value;\n if (stop) { // store is ready\n const run_queue = !subscriber_queue.length;\n for (let i = 0; i < subscribers.length; i += 1) {\n const s = subscribers[i];\n s[1]();\n subscriber_queue.push(s, value);\n }\n if (run_queue) {\n for (let i = 0; i < subscriber_queue.length; i += 2) {\n subscriber_queue[i][0](subscriber_queue[i + 1]);\n }\n subscriber_queue.length = 0;\n }\n }\n }\n }\n function update(fn) {\n set(fn(value));\n }\n function subscribe(run, invalidate = noop) {\n const subscriber = [run, invalidate];\n subscribers.push(subscriber);\n if (subscribers.length === 1) {\n stop = start(set) || noop;\n }\n run(value);\n return () => {\n const index = subscribers.indexOf(subscriber);\n if (index !== -1) {\n subscribers.splice(index, 1);\n }\n if (subscribers.length === 0) {\n stop();\n stop = null;\n }\n };\n }\n return { set, update, subscribe };\n}\nfunction derived(stores, fn, initial_value) {\n const single = !Array.isArray(stores);\n const stores_array = single\n ? [stores]\n : stores;\n const auto = fn.length < 2;\n return readable(initial_value, (set) => {\n let inited = false;\n const values = [];\n let pending = 0;\n let cleanup = noop;\n const sync = () => {\n if (pending) {\n return;\n }\n cleanup();\n const result = fn(single ? values[0] : values, set);\n if (auto) {\n set(result);\n }\n else {\n cleanup = is_function(result) ? result : noop;\n }\n };\n const unsubscribers = stores_array.map((store, i) => subscribe(store, (value) => {\n values[i] = value;\n pending &= ~(1 << i);\n if (inited) {\n sync();\n }\n }, () => {\n pending |= (1 << i);\n }));\n inited = true;\n sync();\n return function stop() {\n run_all(unsubscribers);\n cleanup();\n };\n });\n}\n\nexport { derived, readable, writable };\n","export default function (str, loose) {\n\tif (str instanceof RegExp) return { keys:false, pattern:str };\n\tvar c, o, tmp, ext, keys=[], pattern='', arr = str.split('/');\n\tarr[0] || arr.shift();\n\n\twhile (tmp = arr.shift()) {\n\t\tc = tmp[0];\n\t\tif (c === '*') {\n\t\t\tkeys.push('wild');\n\t\t\tpattern += '/(.*)';\n\t\t} else if (c === ':') {\n\t\t\to = tmp.indexOf('?', 1);\n\t\t\text = tmp.indexOf('.', 1);\n\t\t\tkeys.push( tmp.substring(1, !!~o ? o : !!~ext ? ext : tmp.length) );\n\t\t\tpattern += !!~o && !~ext ? '(?:/([^/]+?))?' : '/([^/]+?)';\n\t\t\tif (!!~ext) pattern += (!!~o ? '?' : '') + '\\\\' + tmp.substring(ext);\n\t\t} else {\n\t\t\tpattern += '/' + tmp;\n\t\t}\n\t}\n\n\treturn {\n\t\tkeys: keys,\n\t\tpattern: new RegExp('^' + pattern + (loose ? '(?=$|\\/)' : '\\/?$'), 'i')\n\t};\n}\n","\n\n{#if componentParams}\n \n{:else}\n \n{/if}\n\n\n","\n\n\n\n\n \n\n","const noDepth = [\"white\", \"black\", \"transparent\"];\n\nfunction getClass(prop, color, depth, defaultDepth) {\n if (noDepth.includes(color)) {\n return `${prop}-${color}`;\n }\n return `${prop}-${color}-${depth || defaultDepth} `;\n}\n\nexport default function utils(color, defaultDepth = 500) {\n return {\n bg: depth => getClass(\"bg\", color, depth, defaultDepth),\n border: depth => getClass(\"border\", color, depth, defaultDepth),\n txt: depth => getClass(\"text\", color, depth, defaultDepth),\n caret: depth => getClass(\"caret\", color, depth, defaultDepth)\n };\n}\n\nexport class ClassBuilder {\n constructor(classes, defaultClasses) {\n this.defaults =\n (typeof classes === \"function\" ? classes(defaultClasses) : classes) ||\n defaultClasses;\n\n this.classes = this.defaults;\n }\n\n flush() {\n this.classes = this.defaults;\n\n return this;\n }\n\n extend(...fns) {\n return this;\n }\n\n get() {\n return this.classes;\n }\n\n replace(classes, cond = true) {\n if (cond && classes) {\n this.classes = Object.keys(classes).reduce(\n (acc, from) => acc.replace(new RegExp(from, \"g\"), classes[from]),\n this.classes\n );\n }\n\n return this;\n }\n\n remove(classes, cond = true) {\n if (cond && classes) {\n this.classes = classes\n .split(\" \")\n .reduce(\n (acc, cur) => acc.replace(new RegExp(cur, \"g\"), \"\"),\n this.classes\n );\n }\n\n return this;\n }\n\n add(className, cond = true, defaultValue) {\n if (!cond || !className) return this;\n\n switch (typeof className) {\n case \"string\":\n default:\n this.classes += ` ${className} `;\n return this;\n case \"function\":\n this.classes += ` ${className(defaultValue || this.classes)} `;\n return this;\n }\n }\n}\n\nconst defaultReserved = [\"class\", \"add\", \"remove\", \"replace\", \"value\"];\n\nexport function filterProps(reserved, props) {\n const r = [...reserved, ...defaultReserved];\n\n return Object.keys(props).reduce(\n (acc, cur) =>\n cur.includes(\"$$\") || cur.includes(\"Class\") || r.includes(cur)\n ? acc\n : { ...acc, [cur]: props[cur] },\n {}\n );\n}\n","// Thanks Lagden! https://svelte.dev/repl/61d9178d2b9944f2aa2bfe31612ab09f?version=3.6.7\nfunction ripple(color, centered) {\n return function(event) {\n const target = event.currentTarget;\n const circle = document.createElement(\"span\");\n const d = Math.max(target.clientWidth, target.clientHeight);\n\n const removeCircle = () => {\n circle.remove();\n circle.removeEventListener(\"animationend\", removeCircle);\n };\n\n circle.addEventListener(\"animationend\", removeCircle);\n circle.style.width = circle.style.height = `${d}px`;\n const rect = target.getBoundingClientRect();\n\n if (centered) {\n circle.classList.add(\n \"absolute\",\n \"top-0\",\n \"left-0\",\n \"ripple-centered\",\n `bg-${color}-transDark`\n );\n } else {\n circle.style.left = `${event.clientX - rect.left - d / 2}px`;\n circle.style.top = `${event.clientY - rect.top - d / 2}px`;\n\n circle.classList.add(\"ripple-normal\", `bg-${color}-trans`);\n }\n\n circle.classList.add(\"ripple\");\n\n target.appendChild(circle);\n };\n}\n\nexport default function r(color = \"primary\", centered = false) {\n return function(node) {\n const onMouseDown = ripple(color, centered);\n node.addEventListener(\"mousedown\", onMouseDown);\n\n return {\n onDestroy: () => node.removeEventListener(\"mousedown\", onMouseDown),\n };\n };\n}\n","\n\n\n{#if href}\n \n (value = !value)}\n on:click\n on:mouseover\n on:*\n >\n {#if icon}\n {icon}\n {/if}\n \n \n \n{:else}\n (value = !value)}\n on:click\n on:mouseover\n on:*\n >\n {#if icon}\n {icon}\n {/if}\n \n \n{/if}\n","\n\n\n \n \n \n \n \n\n","export { identity as linear } from '../internal/index.mjs';\n\n/*\nAdapted from https://github.com/mattdesl\nDistributed under MIT License https://github.com/mattdesl/eases/blob/master/LICENSE.md\n*/\nfunction backInOut(t) {\n const s = 1.70158 * 1.525;\n if ((t *= 2) < 1)\n return 0.5 * (t * t * ((s + 1) * t - s));\n return 0.5 * ((t -= 2) * t * ((s + 1) * t + s) + 2);\n}\nfunction backIn(t) {\n const s = 1.70158;\n return t * t * ((s + 1) * t - s);\n}\nfunction backOut(t) {\n const s = 1.70158;\n return --t * t * ((s + 1) * t + s) + 1;\n}\nfunction bounceOut(t) {\n const a = 4.0 / 11.0;\n const b = 8.0 / 11.0;\n const c = 9.0 / 10.0;\n const ca = 4356.0 / 361.0;\n const cb = 35442.0 / 1805.0;\n const cc = 16061.0 / 1805.0;\n const t2 = t * t;\n return t < a\n ? 7.5625 * t2\n : t < b\n ? 9.075 * t2 - 9.9 * t + 3.4\n : t < c\n ? ca * t2 - cb * t + cc\n : 10.8 * t * t - 20.52 * t + 10.72;\n}\nfunction bounceInOut(t) {\n return t < 0.5\n ? 0.5 * (1.0 - bounceOut(1.0 - t * 2.0))\n : 0.5 * bounceOut(t * 2.0 - 1.0) + 0.5;\n}\nfunction bounceIn(t) {\n return 1.0 - bounceOut(1.0 - t);\n}\nfunction circInOut(t) {\n if ((t *= 2) < 1)\n return -0.5 * (Math.sqrt(1 - t * t) - 1);\n return 0.5 * (Math.sqrt(1 - (t -= 2) * t) + 1);\n}\nfunction circIn(t) {\n return 1.0 - Math.sqrt(1.0 - t * t);\n}\nfunction circOut(t) {\n return Math.sqrt(1 - --t * t);\n}\nfunction cubicInOut(t) {\n return t < 0.5 ? 4.0 * t * t * t : 0.5 * Math.pow(2.0 * t - 2.0, 3.0) + 1.0;\n}\nfunction cubicIn(t) {\n return t * t * t;\n}\nfunction cubicOut(t) {\n const f = t - 1.0;\n return f * f * f + 1.0;\n}\nfunction elasticInOut(t) {\n return t < 0.5\n ? 0.5 *\n Math.sin(((+13.0 * Math.PI) / 2) * 2.0 * t) *\n Math.pow(2.0, 10.0 * (2.0 * t - 1.0))\n : 0.5 *\n Math.sin(((-13.0 * Math.PI) / 2) * (2.0 * t - 1.0 + 1.0)) *\n Math.pow(2.0, -10.0 * (2.0 * t - 1.0)) +\n 1.0;\n}\nfunction elasticIn(t) {\n return Math.sin((13.0 * t * Math.PI) / 2) * Math.pow(2.0, 10.0 * (t - 1.0));\n}\nfunction elasticOut(t) {\n return (Math.sin((-13.0 * (t + 1.0) * Math.PI) / 2) * Math.pow(2.0, -10.0 * t) + 1.0);\n}\nfunction expoInOut(t) {\n return t === 0.0 || t === 1.0\n ? t\n : t < 0.5\n ? +0.5 * Math.pow(2.0, 20.0 * t - 10.0)\n : -0.5 * Math.pow(2.0, 10.0 - t * 20.0) + 1.0;\n}\nfunction expoIn(t) {\n return t === 0.0 ? t : Math.pow(2.0, 10.0 * (t - 1.0));\n}\nfunction expoOut(t) {\n return t === 1.0 ? t : 1.0 - Math.pow(2.0, -10.0 * t);\n}\nfunction quadInOut(t) {\n t /= 0.5;\n if (t < 1)\n return 0.5 * t * t;\n t--;\n return -0.5 * (t * (t - 2) - 1);\n}\nfunction quadIn(t) {\n return t * t;\n}\nfunction quadOut(t) {\n return -t * (t - 2.0);\n}\nfunction quartInOut(t) {\n return t < 0.5\n ? +8.0 * Math.pow(t, 4.0)\n : -8.0 * Math.pow(t - 1.0, 4.0) + 1.0;\n}\nfunction quartIn(t) {\n return Math.pow(t, 4.0);\n}\nfunction quartOut(t) {\n return Math.pow(t - 1.0, 3.0) * (1.0 - t) + 1.0;\n}\nfunction quintInOut(t) {\n if ((t *= 2) < 1)\n return 0.5 * t * t * t * t * t;\n return 0.5 * ((t -= 2) * t * t * t * t + 2);\n}\nfunction quintIn(t) {\n return t * t * t * t * t;\n}\nfunction quintOut(t) {\n return --t * t * t * t * t + 1;\n}\nfunction sineInOut(t) {\n return -0.5 * (Math.cos(Math.PI * t) - 1);\n}\nfunction sineIn(t) {\n const v = Math.cos(t * Math.PI * 0.5);\n if (Math.abs(v) < 1e-14)\n return 1;\n else\n return 1 - v;\n}\nfunction sineOut(t) {\n return Math.sin((t * Math.PI) / 2);\n}\n\nexport { backIn, backInOut, backOut, bounceIn, bounceInOut, bounceOut, circIn, circInOut, circOut, cubicIn, cubicInOut, cubicOut, elasticIn, elasticInOut, elasticOut, expoIn, expoInOut, expoOut, quadIn, quadInOut, quadOut, quartIn, quartInOut, quartOut, quintIn, quintInOut, quintOut, sineIn, sineInOut, sineOut };\n","import { cubicInOut, linear, cubicOut } from '../easing/index.mjs';\nimport { is_function, assign } from '../internal/index.mjs';\n\n/*! *****************************************************************************\r\nCopyright (c) Microsoft Corporation.\r\n\r\nPermission to use, copy, modify, and/or distribute this software for any\r\npurpose with or without fee is hereby granted.\r\n\r\nTHE SOFTWARE IS PROVIDED \"AS IS\" AND THE AUTHOR DISCLAIMS ALL WARRANTIES WITH\r\nREGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF MERCHANTABILITY\r\nAND FITNESS. IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY SPECIAL, DIRECT,\r\nINDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES WHATSOEVER RESULTING FROM\r\nLOSS OF USE, DATA OR PROFITS, WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE OR\r\nOTHER TORTIOUS ACTION, ARISING OUT OF OR IN CONNECTION WITH THE USE OR\r\nPERFORMANCE OF THIS SOFTWARE.\r\n***************************************************************************** */\r\n\r\nfunction __rest(s, e) {\r\n var t = {};\r\n for (var p in s) if (Object.prototype.hasOwnProperty.call(s, p) && e.indexOf(p) < 0)\r\n t[p] = s[p];\r\n if (s != null && typeof Object.getOwnPropertySymbols === \"function\")\r\n for (var i = 0, p = Object.getOwnPropertySymbols(s); i < p.length; i++) {\r\n if (e.indexOf(p[i]) < 0 && Object.prototype.propertyIsEnumerable.call(s, p[i]))\r\n t[p[i]] = s[p[i]];\r\n }\r\n return t;\r\n}\n\nfunction blur(node, { delay = 0, duration = 400, easing = cubicInOut, amount = 5, opacity = 0 } = {}) {\n const style = getComputedStyle(node);\n const target_opacity = +style.opacity;\n const f = style.filter === 'none' ? '' : style.filter;\n const od = target_opacity * (1 - opacity);\n return {\n delay,\n duration,\n easing,\n css: (_t, u) => `opacity: ${target_opacity - (od * u)}; filter: ${f} blur(${u * amount}px);`\n };\n}\nfunction fade(node, { delay = 0, duration = 400, easing = linear } = {}) {\n const o = +getComputedStyle(node).opacity;\n return {\n delay,\n duration,\n easing,\n css: t => `opacity: ${t * o}`\n };\n}\nfunction fly(node, { delay = 0, duration = 400, easing = cubicOut, x = 0, y = 0, opacity = 0 } = {}) {\n const style = getComputedStyle(node);\n const target_opacity = +style.opacity;\n const transform = style.transform === 'none' ? '' : style.transform;\n const od = target_opacity * (1 - opacity);\n return {\n delay,\n duration,\n easing,\n css: (t, u) => `\n\t\t\ttransform: ${transform} translate(${(1 - t) * x}px, ${(1 - t) * y}px);\n\t\t\topacity: ${target_opacity - (od * u)}`\n };\n}\nfunction slide(node, { delay = 0, duration = 400, easing = cubicOut } = {}) {\n const style = getComputedStyle(node);\n const opacity = +style.opacity;\n const height = parseFloat(style.height);\n const padding_top = parseFloat(style.paddingTop);\n const padding_bottom = parseFloat(style.paddingBottom);\n const margin_top = parseFloat(style.marginTop);\n const margin_bottom = parseFloat(style.marginBottom);\n const border_top_width = parseFloat(style.borderTopWidth);\n const border_bottom_width = parseFloat(style.borderBottomWidth);\n return {\n delay,\n duration,\n easing,\n css: t => 'overflow: hidden;' +\n `opacity: ${Math.min(t * 20, 1) * opacity};` +\n `height: ${t * height}px;` +\n `padding-top: ${t * padding_top}px;` +\n `padding-bottom: ${t * padding_bottom}px;` +\n `margin-top: ${t * margin_top}px;` +\n `margin-bottom: ${t * margin_bottom}px;` +\n `border-top-width: ${t * border_top_width}px;` +\n `border-bottom-width: ${t * border_bottom_width}px;`\n };\n}\nfunction scale(node, { delay = 0, duration = 400, easing = cubicOut, start = 0, opacity = 0 } = {}) {\n const style = getComputedStyle(node);\n const target_opacity = +style.opacity;\n const transform = style.transform === 'none' ? '' : style.transform;\n const sd = 1 - start;\n const od = target_opacity * (1 - opacity);\n return {\n delay,\n duration,\n easing,\n css: (_t, u) => `\n\t\t\ttransform: ${transform} scale(${1 - (sd * u)});\n\t\t\topacity: ${target_opacity - (od * u)}\n\t\t`\n };\n}\nfunction draw(node, { delay = 0, speed, duration, easing = cubicInOut } = {}) {\n const len = node.getTotalLength();\n if (duration === undefined) {\n if (speed === undefined) {\n duration = 800;\n }\n else {\n duration = len / speed;\n }\n }\n else if (typeof duration === 'function') {\n duration = duration(len);\n }\n return {\n delay,\n duration,\n easing,\n css: (t, u) => `stroke-dasharray: ${t * len} ${u * len}`\n };\n}\nfunction crossfade(_a) {\n var { fallback } = _a, defaults = __rest(_a, [\"fallback\"]);\n const to_receive = new Map();\n const to_send = new Map();\n function crossfade(from, node, params) {\n const { delay = 0, duration = d => Math.sqrt(d) * 30, easing = cubicOut } = assign(assign({}, defaults), params);\n const to = node.getBoundingClientRect();\n const dx = from.left - to.left;\n const dy = from.top - to.top;\n const dw = from.width / to.width;\n const dh = from.height / to.height;\n const d = Math.sqrt(dx * dx + dy * dy);\n const style = getComputedStyle(node);\n const transform = style.transform === 'none' ? '' : style.transform;\n const opacity = +style.opacity;\n return {\n delay,\n duration: is_function(duration) ? duration(d) : duration,\n easing,\n css: (t, u) => `\n\t\t\t\topacity: ${t * opacity};\n\t\t\t\ttransform-origin: top left;\n\t\t\t\ttransform: ${transform} translate(${u * dx}px,${u * dy}px) scale(${t + (1 - t) * dw}, ${t + (1 - t) * dh});\n\t\t\t`\n };\n }\n function transition(items, counterparts, intro) {\n return (node, params) => {\n items.set(params.key, {\n rect: node.getBoundingClientRect()\n });\n return () => {\n if (counterparts.has(params.key)) {\n const { rect } = counterparts.get(params.key);\n counterparts.delete(params.key);\n return crossfade(rect, node, params);\n }\n // if the node is disappearing altogether\n // (i.e. wasn't claimed by the other list)\n // then we need to supply an outro\n items.delete(params.key);\n return fallback && fallback(node, params, intro);\n };\n };\n }\n return [\n transition(to_send, to_receive, false),\n transition(to_receive, to_send, true)\n ];\n}\n\nexport { blur, crossfade, draw, fade, fly, scale, slide };\n","\n\n\n","import scrim from \"./Scrim.svelte\";\nimport spacer from \"./Spacer.svelte\";\n\nexport const Scrim = scrim;\nexport const Spacer = spacer;\n\nexport default {\n Scrim,\n Spacer\n};\n","\n\n{#if value}\n
\n !persistent && (value = false)} />\n
\n \n
\n \n
\n \n
\n \n
\n
\n
\n \n{/if}\n","\n\n\n\n
\n {#if visible}\n \n {/if}\n
\n","\n\n\n {#if loaded}\n \n {:else if thumbnail}\n \n {:else if loading}\n \n {/if}\n\n","\n\n\n {#if icon}\n \n {icon}\n \n {/if}\n\n
\n
\n {text}\n
\n {#if subheading}\n
{subheading}
\n {/if}\n
\n\n","\n\n
    \n {#each items as item, i}\n {#if item.to !== undefined}\n \n \n \n {item.text}\n \n \n \n {:else}\n \n \n {getText(item)}\n \n \n {/if}\n {/each}\n
\n","\n\n\n\n\n","\n\n\n {@html hint || ''}\n {error || ''}\n\n","\n\n\n\n\n \n\n","\n\n
\n {#if label}\n \n {label}\n \n {/if}\n\n {#if (!textarea && !select) || autocomplete}\n \n {:else if textarea && !select}\n \n {:else if select && !autocomplete}\n \n {/if}\n\n {#if append}\n dispatch(\"click-append\")}\n >\n \n \n {append}\n \n \n
\n {/if}\n\n {#if prepend}\n dispatch(\"click-prepend\")}\n >\n \n \n {prepend}\n \n \n \n {/if}\n\n \n\n {#if showHint}\n \n {/if}\n\n","\n\n (open = false)} />\n\n
\n \n \n {#if open}\n
\n open = false}\n {...listProps}\n />\n
\n {/if}\n
\n
\n","\n\n\n {label}\n\n","\n\n\n\n\n \n\n","\n\n
\n
\n \n
\n \n {#if checked}\n \n check_box\n \n {:else}\n \n check_box_outline_blank\n \n {/if}\n \n
\n \n \n
\n
\n","export function hideListAction(node, cb) {\r\n const onWindowClick = e => {\r\n if (!node.contains(e.target)) {\r\n cb();\r\n }\r\n };\r\n\r\n window.addEventListener(\"click\", onWindowClick);\r\n\r\n return {\r\n destroy: () => {\r\n window.removeEventListener(\"click\", onWindowClick);\r\n }\r\n };\r\n}\r\n","\n\n
\n \n showList = !showList)}\n on:click\n on:input={filterItems}\n appendReverse={showList}\n />\n \n\n {#if showList}\n \n (showList = false)}\n >\n {\n dispatch('change', detail);\n }} />\n
\n
\n {/if}\n\n","\n\n\n\n\n \n\n","\n\n\n\n\n\n{#if value && (running === hash)}\n \n
\n value = false}>\n \n {#if !noAction}\n \n \n {#if !timeout}\n \n {/if}\n \n {/if}\n
\n \n \n{/if}\n","\n\n
\n \n
\n
\n \n \n \n
\n \n
\n","function decodeLocale(locale) {\n return locale.match(\n /^([a-zA-Z]{2,3})(?:[_-]+([a-zA-Z]{3})(?=$|[_-]+))?(?:[_-]+([a-zA-Z]{4})(?=$|[_-]+))?(?:[_-]+([a-zA-Z]{2}|\\d{3})(?=$|[_-]+))?/\n );\n}\n\nexport function getWeekDays(locale, firstDayOfWeek) {\n let i = 0;\n var baseDate = new Date(Date.UTC(2017, 0, firstDayOfWeek + 1));\n var weekDays = [];\n for (i = 0; i < 7; i++) {\n weekDays.push(baseDate.toLocaleDateString(locale, { weekday: \"narrow\" }));\n baseDate.setDate(baseDate.getDate() + 1);\n }\n return weekDays;\n}\n\nexport function weekStart(locale) {\n if (locale === \"default\") return 0;\n\n const name = decodeLocale(locale)[4];\n if (\"AEAFBHDJDZEGIQIRJOKWLYOMQASDSY\".match(/../g).includes(name)) {\n return 6;\n }\n if (\n \"AGARASAUBDBRBSBTBWBZCACNCODMDOETGTGUHKHNIDILINJMJPKEKHKRLAMHMMMOMTMXMZNINPPAPEPHPKPRPTPYSASGSVTHTTTWUMUSVEVIWSYEZAZW\"\n .match(/../g)\n .includes(name)\n ) {\n return 0;\n }\n return 1;\n}\n","\n\n
\n \n
\n {year} {month}\n
\n \n \n
\n
\n\n
\n
\n {#each weekdays as weekday}\n
\n {weekday}\n
\n {/each}\n
\n
\n {#if dayOffset}
{/if}\n {#each daysInMonth as i}\n
\n
select(i.day)}\n >\n \n {i.day}\n \n
\n
\n {/each}\n
\n
\n \n
\n","import { writable } from 'svelte/store'\n\nlet user = {\n username: '',\n userInfo: null,\n roles: [],\n blocked: false\n}\n\nexport function is(userRoles, ...roles) {\n return roles.some(role => userRoles.includes(role))\n}\n\nexport let userStore = writable(user)\n\nexport const cleanUserStore = () => {\n localStorage.clear()\n userStore.update(p => ({ ...p, username: null, userInfo: null, roles: [] }))\n}\n\nexport const showLockInfo = () => {\n userStore.update(p => ({ ...p, blocked: true}))\n}\n\nexport let cities = writable([])\nexport let countries = writable([])\n\nlet installedBase = {\n machine_no: ''\n}\n\nexport let selectedInstalledBase = writable(installedBase)\n\n// filters with select items\nexport let selectedGroups = writable({})\n\nlet _projectFilters = {\n platforms: {key: 'platforms', value: '', label: 'Machine model / Product group', select: []},\n models: {key: 'models', value: '', label: 'Platform', select: []},\n\n WarrantyDate1: {\n key: 'WarrantyDate', value: '', label: 'from', spec: 'min', date: true,\n roles: ['ib_sales_unit', 'ib_supervisor'],\n group: 'Warranty end date',\n },\n WarrantyDate2: {\n key: 'WarrantyDate', value: '', label: 'to', spec: 'max', date: true,\n roles: ['ib_sales_unit', 'ib_supervisor'],\n group: 'Warranty end date',\n },\n\n su_erp_proj: {key: 'su_erp_proj', value: '', label: 'Project number'},\n\n eu_name: {key: 'eu_name', value: '', label: 'End user name'},\n eu_city: {\n key: 'eu_city',\n value: '',\n label: 'End user city',\n city: true,\n country: 'eu_country'\n },\n eu_country: {key: 'eu_country', value: '', label: 'End user country', country: true},\n\n shcu_name: {key: 'shcu_name', value: '', label: 'Ship to customer name'},\n shcu_city: {\n key: 'shcu_city',\n value: '',\n label: 'Ship to city',\n city: true,\n country: 'shcu_country'\n },\n shcu_country: {key: 'shcu_country', value: '', label: 'Ship to country', country: true},\n\n sa: {\n key: 'sa', value: '', label: 'Service agreement signed', select: [],\n roles: ['ib_sales_unit', 'ib_supervisor']\n },\n sa_end1: {\n key: 'sa_end', value: '', label: 'from', spec: 'min', date: true,\n roles: ['ib_sales_unit', 'ib_supervisor'],\n group: 'Service agreement end',\n },\n sa_end2: {\n key: 'sa_end', value: '', label: 'to', spec: 'max', date: true,\n roles: ['ib_sales_unit', 'ib_supervisor'],\n group: 'Service agreement end',\n },\n AssetValue: {\n key: 'AssetValue', value: '', label: 'Asset value, min', spec: 'min', type: 'number',\n roles: ['ib_sales_unit', 'ib_supervisor']\n },\n\n country_key: {key: 'country_key', value: '', label: 'Sales office', select: []},\n\n serials: {\n key: 'serials', min_value: '', max_value: '', label: 'Serial number', range_list: true,\n roles: ['ib_sales_unit', 'ib_supervisor'],\n group: 'Serial number',\n },\n\n GKAM: {\n key: 'GKAM', value: '', label: 'Key account', select: [],\n roles: ['ib_sales_unit', 'ib_supervisor']\n },\n\n op_center: {\n key: 'op_center', value: '', label: 'Operation center', select: [],\n roles: ['ib_sales_unit', 'ib_supervisor']\n },\n\n is_sat: {\n key: 'is_sat', value: '', label: 'SAT is signed', select: [],\n roles: ['ib_sales_unit', 'ib_supervisor']\n },\n\n SATDate1: {\n key: 'SATDate', value: '', label: 'from', spec: 'min', date: true,\n roles: ['ib_sales_unit', 'ib_supervisor'],\n group: \"SAT date\"\n },\n SATDate2: {\n key: 'SATDate', value: '', label: 'to', spec: 'max', date: true,\n roles: ['ib_sales_unit', 'ib_supervisor'],\n group: \"SAT date\"\n },\n\n // sales_unit: {key: 'sales_unit', value: '', label: 'Sales unit'},\n}\n\nlet _machineFilters = {\n ProductGroup: {key: 'ProductGroup', value: '', label: 'Machine model / Product group', select: []},\n model: {key: 'model', value: '', label: 'Platform', select: []},\n\n WarrantyDate1: {\n key: 'WarrantyDate', value: '', label: 'from', spec: 'min', date: true,\n roles: ['ib_sales_unit', 'ib_supervisor'],\n group: 'Warranty end date',\n },\n WarrantyDate2: {\n key: 'WarrantyDate', value: '', label: 'to', spec: 'max', date: true,\n roles: ['ib_sales_unit', 'ib_supervisor'],\n group: 'Warranty end date',\n },\n\n su_erp_proj: {key: 'su_erp_proj', value: '', label: 'Project number'},\n\n eu_name: {key: 'eu_name', value: '', label: 'End user name'},\n eu_city: {\n key: 'eu_city',\n value: '',\n label: 'End user city',\n city: true,\n country: 'eu_country'\n },\n eu_country: {key: 'eu_country', value: '', label: 'End user country', country: true},\n\n shcu_name: {key: 'shcu_name', value: '', label: 'Ship to customer name'},\n shcu_city: {\n key: 'shcu_city',\n value: '',\n label: 'Ship to city',\n city: true,\n country: 'shcu_country'\n },\n shcu_country: {key: 'shcu_country', value: '', label: 'Ship to country', country: true},\n\n sa: {\n key: 'sa', value: '', label: 'Service agreement signed', select: [],\n roles: ['ib_sales_unit', 'ib_supervisor']\n },\n sa_end1: {\n key: 'sa_end', value: '', label: 'from', spec: 'min', date: true,\n roles: ['ib_sales_unit', 'ib_supervisor'],\n group: 'Service agreement end',\n },\n sa_end2: {\n key: 'sa_end', value: '', label: 'to', spec: 'max', date: true,\n roles: ['ib_sales_unit', 'ib_supervisor'],\n group: 'Service agreement end',\n },\n\n country_key: {key: 'country_key', value: '', label: 'Sales office', select: []},\n\n serial: {\n key: 'sn', min_value: '', max_value: '', label: 'Serial number', range_list: true,\n roles: ['ib_sales_unit', 'ib_supervisor'],\n group: ['Serial number']\n },\n\n GKAM: {\n key: 'GKAM', value: '', label: 'Key account', select: [],\n roles: ['ib_sales_unit', 'ib_supervisor']\n },\n\n op_center: {\n key: 'op_center', value: '', label: 'Operation center', select: [],\n roles: ['ib_sales_unit', 'ib_supervisor']\n },\n\n is_sat: {\n key: 'is_sat', value: '', label: 'SAT is signed', select: [],\n roles: ['ib_sales_unit', 'ib_supervisor']\n },\n\n status: {key: 'status', value: '', label: 'Status'},\n\n unit_serial: {\n key: 'unit_serial', value: '', label: 'Unit number',\n roles: ['ib_sales_unit', 'ib_supervisor']\n },\n\n machine_id: {key: 'no', value: '', label: 'Machine ID'},\n\n // sales_unit: {key: 'sales_unit', value: '', label: 'Sales unit'},\n}\n\nexport let projectFilters = writable(_projectFilters)\nexport let machineFilters = writable(_machineFilters)\n\nexport let filtersView = writable([])\n\nexport let filteredProjects = writable([])\nexport let filteredMachines = writable([])\n\n","'use strict';\n\nmodule.exports = function bind(fn, thisArg) {\n return function wrap() {\n var args = new Array(arguments.length);\n for (var i = 0; i < args.length; i++) {\n args[i] = arguments[i];\n }\n return fn.apply(thisArg, args);\n };\n};\n","'use strict';\n\nvar bind = require('./helpers/bind');\n\n/*global toString:true*/\n\n// utils is a library of generic helper functions non-specific to axios\n\nvar toString = Object.prototype.toString;\n\n/**\n * Determine if a value is an Array\n *\n * @param {Object} val The value to test\n * @returns {boolean} True if value is an Array, otherwise false\n */\nfunction isArray(val) {\n return toString.call(val) === '[object Array]';\n}\n\n/**\n * Determine if a value is undefined\n *\n * @param {Object} val The value to test\n * @returns {boolean} True if the value is undefined, otherwise false\n */\nfunction isUndefined(val) {\n return typeof val === 'undefined';\n}\n\n/**\n * Determine if a value is a Buffer\n *\n * @param {Object} val The value to test\n * @returns {boolean} True if value is a Buffer, otherwise false\n */\nfunction isBuffer(val) {\n return val !== null && !isUndefined(val) && val.constructor !== null && !isUndefined(val.constructor)\n && typeof val.constructor.isBuffer === 'function' && val.constructor.isBuffer(val);\n}\n\n/**\n * Determine if a value is an ArrayBuffer\n *\n * @param {Object} val The value to test\n * @returns {boolean} True if value is an ArrayBuffer, otherwise false\n */\nfunction isArrayBuffer(val) {\n return toString.call(val) === '[object ArrayBuffer]';\n}\n\n/**\n * Determine if a value is a FormData\n *\n * @param {Object} val The value to test\n * @returns {boolean} True if value is an FormData, otherwise false\n */\nfunction isFormData(val) {\n return (typeof FormData !== 'undefined') && (val instanceof FormData);\n}\n\n/**\n * Determine if a value is a view on an ArrayBuffer\n *\n * @param {Object} val The value to test\n * @returns {boolean} True if value is a view on an ArrayBuffer, otherwise false\n */\nfunction isArrayBufferView(val) {\n var result;\n if ((typeof ArrayBuffer !== 'undefined') && (ArrayBuffer.isView)) {\n result = ArrayBuffer.isView(val);\n } else {\n result = (val) && (val.buffer) && (val.buffer instanceof ArrayBuffer);\n }\n return result;\n}\n\n/**\n * Determine if a value is a String\n *\n * @param {Object} val The value to test\n * @returns {boolean} True if value is a String, otherwise false\n */\nfunction isString(val) {\n return typeof val === 'string';\n}\n\n/**\n * Determine if a value is a Number\n *\n * @param {Object} val The value to test\n * @returns {boolean} True if value is a Number, otherwise false\n */\nfunction isNumber(val) {\n return typeof val === 'number';\n}\n\n/**\n * Determine if a value is an Object\n *\n * @param {Object} val The value to test\n * @returns {boolean} True if value is an Object, otherwise false\n */\nfunction isObject(val) {\n return val !== null && typeof val === 'object';\n}\n\n/**\n * Determine if a value is a Date\n *\n * @param {Object} val The value to test\n * @returns {boolean} True if value is a Date, otherwise false\n */\nfunction isDate(val) {\n return toString.call(val) === '[object Date]';\n}\n\n/**\n * Determine if a value is a File\n *\n * @param {Object} val The value to test\n * @returns {boolean} True if value is a File, otherwise false\n */\nfunction isFile(val) {\n return toString.call(val) === '[object File]';\n}\n\n/**\n * Determine if a value is a Blob\n *\n * @param {Object} val The value to test\n * @returns {boolean} True if value is a Blob, otherwise false\n */\nfunction isBlob(val) {\n return toString.call(val) === '[object Blob]';\n}\n\n/**\n * Determine if a value is a Function\n *\n * @param {Object} val The value to test\n * @returns {boolean} True if value is a Function, otherwise false\n */\nfunction isFunction(val) {\n return toString.call(val) === '[object Function]';\n}\n\n/**\n * Determine if a value is a Stream\n *\n * @param {Object} val The value to test\n * @returns {boolean} True if value is a Stream, otherwise false\n */\nfunction isStream(val) {\n return isObject(val) && isFunction(val.pipe);\n}\n\n/**\n * Determine if a value is a URLSearchParams object\n *\n * @param {Object} val The value to test\n * @returns {boolean} True if value is a URLSearchParams object, otherwise false\n */\nfunction isURLSearchParams(val) {\n return typeof URLSearchParams !== 'undefined' && val instanceof URLSearchParams;\n}\n\n/**\n * Trim excess whitespace off the beginning and end of a string\n *\n * @param {String} str The String to trim\n * @returns {String} The String freed of excess whitespace\n */\nfunction trim(str) {\n return str.replace(/^\\s*/, '').replace(/\\s*$/, '');\n}\n\n/**\n * Determine if we're running in a standard browser environment\n *\n * This allows axios to run in a web worker, and react-native.\n * Both environments support XMLHttpRequest, but not fully standard globals.\n *\n * web workers:\n * typeof window -> undefined\n * typeof document -> undefined\n *\n * react-native:\n * navigator.product -> 'ReactNative'\n * nativescript\n * navigator.product -> 'NativeScript' or 'NS'\n */\nfunction isStandardBrowserEnv() {\n if (typeof navigator !== 'undefined' && (navigator.product === 'ReactNative' ||\n navigator.product === 'NativeScript' ||\n navigator.product === 'NS')) {\n return false;\n }\n return (\n typeof window !== 'undefined' &&\n typeof document !== 'undefined'\n );\n}\n\n/**\n * Iterate over an Array or an Object invoking a function for each item.\n *\n * If `obj` is an Array callback will be called passing\n * the value, index, and complete array for each item.\n *\n * If 'obj' is an Object callback will be called passing\n * the value, key, and complete object for each property.\n *\n * @param {Object|Array} obj The object to iterate\n * @param {Function} fn The callback to invoke for each item\n */\nfunction forEach(obj, fn) {\n // Don't bother if no value provided\n if (obj === null || typeof obj === 'undefined') {\n return;\n }\n\n // Force an array if not already something iterable\n if (typeof obj !== 'object') {\n /*eslint no-param-reassign:0*/\n obj = [obj];\n }\n\n if (isArray(obj)) {\n // Iterate over array values\n for (var i = 0, l = obj.length; i < l; i++) {\n fn.call(null, obj[i], i, obj);\n }\n } else {\n // Iterate over object keys\n for (var key in obj) {\n if (Object.prototype.hasOwnProperty.call(obj, key)) {\n fn.call(null, obj[key], key, obj);\n }\n }\n }\n}\n\n/**\n * Accepts varargs expecting each argument to be an object, then\n * immutably merges the properties of each object and returns result.\n *\n * When multiple objects contain the same key the later object in\n * the arguments list will take precedence.\n *\n * Example:\n *\n * ```js\n * var result = merge({foo: 123}, {foo: 456});\n * console.log(result.foo); // outputs 456\n * ```\n *\n * @param {Object} obj1 Object to merge\n * @returns {Object} Result of all merge properties\n */\nfunction merge(/* obj1, obj2, obj3, ... */) {\n var result = {};\n function assignValue(val, key) {\n if (typeof result[key] === 'object' && typeof val === 'object') {\n result[key] = merge(result[key], val);\n } else {\n result[key] = val;\n }\n }\n\n for (var i = 0, l = arguments.length; i < l; i++) {\n forEach(arguments[i], assignValue);\n }\n return result;\n}\n\n/**\n * Function equal to merge with the difference being that no reference\n * to original objects is kept.\n *\n * @see merge\n * @param {Object} obj1 Object to merge\n * @returns {Object} Result of all merge properties\n */\nfunction deepMerge(/* obj1, obj2, obj3, ... */) {\n var result = {};\n function assignValue(val, key) {\n if (typeof result[key] === 'object' && typeof val === 'object') {\n result[key] = deepMerge(result[key], val);\n } else if (typeof val === 'object') {\n result[key] = deepMerge({}, val);\n } else {\n result[key] = val;\n }\n }\n\n for (var i = 0, l = arguments.length; i < l; i++) {\n forEach(arguments[i], assignValue);\n }\n return result;\n}\n\n/**\n * Extends object a by mutably adding to it the properties of object b.\n *\n * @param {Object} a The object to be extended\n * @param {Object} b The object to copy properties from\n * @param {Object} thisArg The object to bind function to\n * @return {Object} The resulting value of object a\n */\nfunction extend(a, b, thisArg) {\n forEach(b, function assignValue(val, key) {\n if (thisArg && typeof val === 'function') {\n a[key] = bind(val, thisArg);\n } else {\n a[key] = val;\n }\n });\n return a;\n}\n\nmodule.exports = {\n isArray: isArray,\n isArrayBuffer: isArrayBuffer,\n isBuffer: isBuffer,\n isFormData: isFormData,\n isArrayBufferView: isArrayBufferView,\n isString: isString,\n isNumber: isNumber,\n isObject: isObject,\n isUndefined: isUndefined,\n isDate: isDate,\n isFile: isFile,\n isBlob: isBlob,\n isFunction: isFunction,\n isStream: isStream,\n isURLSearchParams: isURLSearchParams,\n isStandardBrowserEnv: isStandardBrowserEnv,\n forEach: forEach,\n merge: merge,\n deepMerge: deepMerge,\n extend: extend,\n trim: trim\n};\n","'use strict';\n\nvar utils = require('./../utils');\n\nfunction encode(val) {\n return encodeURIComponent(val).\n replace(/%40/gi, '@').\n replace(/%3A/gi, ':').\n replace(/%24/g, '$').\n replace(/%2C/gi, ',').\n replace(/%20/g, '+').\n replace(/%5B/gi, '[').\n replace(/%5D/gi, ']');\n}\n\n/**\n * Build a URL by appending params to the end\n *\n * @param {string} url The base of the url (e.g., http://www.google.com)\n * @param {object} [params] The params to be appended\n * @returns {string} The formatted url\n */\nmodule.exports = function buildURL(url, params, paramsSerializer) {\n /*eslint no-param-reassign:0*/\n if (!params) {\n return url;\n }\n\n var serializedParams;\n if (paramsSerializer) {\n serializedParams = paramsSerializer(params);\n } else if (utils.isURLSearchParams(params)) {\n serializedParams = params.toString();\n } else {\n var parts = [];\n\n utils.forEach(params, function serialize(val, key) {\n if (val === null || typeof val === 'undefined') {\n return;\n }\n\n if (utils.isArray(val)) {\n key = key + '[]';\n } else {\n val = [val];\n }\n\n utils.forEach(val, function parseValue(v) {\n if (utils.isDate(v)) {\n v = v.toISOString();\n } else if (utils.isObject(v)) {\n v = JSON.stringify(v);\n }\n parts.push(encode(key) + '=' + encode(v));\n });\n });\n\n serializedParams = parts.join('&');\n }\n\n if (serializedParams) {\n var hashmarkIndex = url.indexOf('#');\n if (hashmarkIndex !== -1) {\n url = url.slice(0, hashmarkIndex);\n }\n\n url += (url.indexOf('?') === -1 ? '?' : '&') + serializedParams;\n }\n\n return url;\n};\n","'use strict';\n\nvar utils = require('./../utils');\n\nfunction InterceptorManager() {\n this.handlers = [];\n}\n\n/**\n * Add a new interceptor to the stack\n *\n * @param {Function} fulfilled The function to handle `then` for a `Promise`\n * @param {Function} rejected The function to handle `reject` for a `Promise`\n *\n * @return {Number} An ID used to remove interceptor later\n */\nInterceptorManager.prototype.use = function use(fulfilled, rejected) {\n this.handlers.push({\n fulfilled: fulfilled,\n rejected: rejected\n });\n return this.handlers.length - 1;\n};\n\n/**\n * Remove an interceptor from the stack\n *\n * @param {Number} id The ID that was returned by `use`\n */\nInterceptorManager.prototype.eject = function eject(id) {\n if (this.handlers[id]) {\n this.handlers[id] = null;\n }\n};\n\n/**\n * Iterate over all the registered interceptors\n *\n * This method is particularly useful for skipping over any\n * interceptors that may have become `null` calling `eject`.\n *\n * @param {Function} fn The function to call for each interceptor\n */\nInterceptorManager.prototype.forEach = function forEach(fn) {\n utils.forEach(this.handlers, function forEachHandler(h) {\n if (h !== null) {\n fn(h);\n }\n });\n};\n\nmodule.exports = InterceptorManager;\n","'use strict';\n\nvar utils = require('./../utils');\n\n/**\n * Transform the data for a request or a response\n *\n * @param {Object|String} data The data to be transformed\n * @param {Array} headers The headers for the request or response\n * @param {Array|Function} fns A single function or Array of functions\n * @returns {*} The resulting transformed data\n */\nmodule.exports = function transformData(data, headers, fns) {\n /*eslint no-param-reassign:0*/\n utils.forEach(fns, function transform(fn) {\n data = fn(data, headers);\n });\n\n return data;\n};\n","'use strict';\n\nmodule.exports = function isCancel(value) {\n return !!(value && value.__CANCEL__);\n};\n","'use strict';\n\nvar utils = require('../utils');\n\nmodule.exports = function normalizeHeaderName(headers, normalizedName) {\n utils.forEach(headers, function processHeader(value, name) {\n if (name !== normalizedName && name.toUpperCase() === normalizedName.toUpperCase()) {\n headers[normalizedName] = value;\n delete headers[name];\n }\n });\n};\n","'use strict';\n\n/**\n * Update an Error with the specified config, error code, and response.\n *\n * @param {Error} error The error to update.\n * @param {Object} config The config.\n * @param {string} [code] The error code (for example, 'ECONNABORTED').\n * @param {Object} [request] The request.\n * @param {Object} [response] The response.\n * @returns {Error} The error.\n */\nmodule.exports = function enhanceError(error, config, code, request, response) {\n error.config = config;\n if (code) {\n error.code = code;\n }\n\n error.request = request;\n error.response = response;\n error.isAxiosError = true;\n\n error.toJSON = function() {\n return {\n // Standard\n message: this.message,\n name: this.name,\n // Microsoft\n description: this.description,\n number: this.number,\n // Mozilla\n fileName: this.fileName,\n lineNumber: this.lineNumber,\n columnNumber: this.columnNumber,\n stack: this.stack,\n // Axios\n config: this.config,\n code: this.code\n };\n };\n return error;\n};\n","'use strict';\n\nvar enhanceError = require('./enhanceError');\n\n/**\n * Create an Error with the specified message, config, error code, request and response.\n *\n * @param {string} message The error message.\n * @param {Object} config The config.\n * @param {string} [code] The error code (for example, 'ECONNABORTED').\n * @param {Object} [request] The request.\n * @param {Object} [response] The response.\n * @returns {Error} The created error.\n */\nmodule.exports = function createError(message, config, code, request, response) {\n var error = new Error(message);\n return enhanceError(error, config, code, request, response);\n};\n","'use strict';\n\nvar createError = require('./createError');\n\n/**\n * Resolve or reject a Promise based on response status.\n *\n * @param {Function} resolve A function that resolves the promise.\n * @param {Function} reject A function that rejects the promise.\n * @param {object} response The response.\n */\nmodule.exports = function settle(resolve, reject, response) {\n var validateStatus = response.config.validateStatus;\n if (!validateStatus || validateStatus(response.status)) {\n resolve(response);\n } else {\n reject(createError(\n 'Request failed with status code ' + response.status,\n response.config,\n null,\n response.request,\n response\n ));\n }\n};\n","'use strict';\n\n/**\n * Determines whether the specified URL is absolute\n *\n * @param {string} url The URL to test\n * @returns {boolean} True if the specified URL is absolute, otherwise false\n */\nmodule.exports = function isAbsoluteURL(url) {\n // A URL is considered absolute if it begins with \"://\" or \"//\" (protocol-relative URL).\n // RFC 3986 defines scheme name as a sequence of characters beginning with a letter and followed\n // by any combination of letters, digits, plus, period, or hyphen.\n return /^([a-z][a-z\\d\\+\\-\\.]*:)?\\/\\//i.test(url);\n};\n","'use strict';\n\n/**\n * Creates a new URL by combining the specified URLs\n *\n * @param {string} baseURL The base URL\n * @param {string} relativeURL The relative URL\n * @returns {string} The combined URL\n */\nmodule.exports = function combineURLs(baseURL, relativeURL) {\n return relativeURL\n ? baseURL.replace(/\\/+$/, '') + '/' + relativeURL.replace(/^\\/+/, '')\n : baseURL;\n};\n","'use strict';\n\nvar isAbsoluteURL = require('../helpers/isAbsoluteURL');\nvar combineURLs = require('../helpers/combineURLs');\n\n/**\n * Creates a new URL by combining the baseURL with the requestedURL,\n * only when the requestedURL is not already an absolute URL.\n * If the requestURL is absolute, this function returns the requestedURL untouched.\n *\n * @param {string} baseURL The base URL\n * @param {string} requestedURL Absolute or relative URL to combine\n * @returns {string} The combined full path\n */\nmodule.exports = function buildFullPath(baseURL, requestedURL) {\n if (baseURL && !isAbsoluteURL(requestedURL)) {\n return combineURLs(baseURL, requestedURL);\n }\n return requestedURL;\n};\n","'use strict';\n\nvar utils = require('./../utils');\n\n// Headers whose duplicates are ignored by node\n// c.f. https://nodejs.org/api/http.html#http_message_headers\nvar ignoreDuplicateOf = [\n 'age', 'authorization', 'content-length', 'content-type', 'etag',\n 'expires', 'from', 'host', 'if-modified-since', 'if-unmodified-since',\n 'last-modified', 'location', 'max-forwards', 'proxy-authorization',\n 'referer', 'retry-after', 'user-agent'\n];\n\n/**\n * Parse headers into an object\n *\n * ```\n * Date: Wed, 27 Aug 2014 08:58:49 GMT\n * Content-Type: application/json\n * Connection: keep-alive\n * Transfer-Encoding: chunked\n * ```\n *\n * @param {String} headers Headers needing to be parsed\n * @returns {Object} Headers parsed into an object\n */\nmodule.exports = function parseHeaders(headers) {\n var parsed = {};\n var key;\n var val;\n var i;\n\n if (!headers) { return parsed; }\n\n utils.forEach(headers.split('\\n'), function parser(line) {\n i = line.indexOf(':');\n key = utils.trim(line.substr(0, i)).toLowerCase();\n val = utils.trim(line.substr(i + 1));\n\n if (key) {\n if (parsed[key] && ignoreDuplicateOf.indexOf(key) >= 0) {\n return;\n }\n if (key === 'set-cookie') {\n parsed[key] = (parsed[key] ? parsed[key] : []).concat([val]);\n } else {\n parsed[key] = parsed[key] ? parsed[key] + ', ' + val : val;\n }\n }\n });\n\n return parsed;\n};\n","'use strict';\n\nvar utils = require('./../utils');\n\nmodule.exports = (\n utils.isStandardBrowserEnv() ?\n\n // Standard browser envs have full support of the APIs needed to test\n // whether the request URL is of the same origin as current location.\n (function standardBrowserEnv() {\n var msie = /(msie|trident)/i.test(navigator.userAgent);\n var urlParsingNode = document.createElement('a');\n var originURL;\n\n /**\n * Parse a URL to discover it's components\n *\n * @param {String} url The URL to be parsed\n * @returns {Object}\n */\n function resolveURL(url) {\n var href = url;\n\n if (msie) {\n // IE needs attribute set twice to normalize properties\n urlParsingNode.setAttribute('href', href);\n href = urlParsingNode.href;\n }\n\n urlParsingNode.setAttribute('href', href);\n\n // urlParsingNode provides the UrlUtils interface - http://url.spec.whatwg.org/#urlutils\n return {\n href: urlParsingNode.href,\n protocol: urlParsingNode.protocol ? urlParsingNode.protocol.replace(/:$/, '') : '',\n host: urlParsingNode.host,\n search: urlParsingNode.search ? urlParsingNode.search.replace(/^\\?/, '') : '',\n hash: urlParsingNode.hash ? urlParsingNode.hash.replace(/^#/, '') : '',\n hostname: urlParsingNode.hostname,\n port: urlParsingNode.port,\n pathname: (urlParsingNode.pathname.charAt(0) === '/') ?\n urlParsingNode.pathname :\n '/' + urlParsingNode.pathname\n };\n }\n\n originURL = resolveURL(window.location.href);\n\n /**\n * Determine if a URL shares the same origin as the current location\n *\n * @param {String} requestURL The URL to test\n * @returns {boolean} True if URL shares the same origin, otherwise false\n */\n return function isURLSameOrigin(requestURL) {\n var parsed = (utils.isString(requestURL)) ? resolveURL(requestURL) : requestURL;\n return (parsed.protocol === originURL.protocol &&\n parsed.host === originURL.host);\n };\n })() :\n\n // Non standard browser envs (web workers, react-native) lack needed support.\n (function nonStandardBrowserEnv() {\n return function isURLSameOrigin() {\n return true;\n };\n })()\n);\n","'use strict';\n\nvar utils = require('./../utils');\n\nmodule.exports = (\n utils.isStandardBrowserEnv() ?\n\n // Standard browser envs support document.cookie\n (function standardBrowserEnv() {\n return {\n write: function write(name, value, expires, path, domain, secure) {\n var cookie = [];\n cookie.push(name + '=' + encodeURIComponent(value));\n\n if (utils.isNumber(expires)) {\n cookie.push('expires=' + new Date(expires).toGMTString());\n }\n\n if (utils.isString(path)) {\n cookie.push('path=' + path);\n }\n\n if (utils.isString(domain)) {\n cookie.push('domain=' + domain);\n }\n\n if (secure === true) {\n cookie.push('secure');\n }\n\n document.cookie = cookie.join('; ');\n },\n\n read: function read(name) {\n var match = document.cookie.match(new RegExp('(^|;\\\\s*)(' + name + ')=([^;]*)'));\n return (match ? decodeURIComponent(match[3]) : null);\n },\n\n remove: function remove(name) {\n this.write(name, '', Date.now() - 86400000);\n }\n };\n })() :\n\n // Non standard browser env (web workers, react-native) lack needed support.\n (function nonStandardBrowserEnv() {\n return {\n write: function write() {},\n read: function read() { return null; },\n remove: function remove() {}\n };\n })()\n);\n","'use strict';\n\nvar utils = require('./../utils');\nvar settle = require('./../core/settle');\nvar buildURL = require('./../helpers/buildURL');\nvar buildFullPath = require('../core/buildFullPath');\nvar parseHeaders = require('./../helpers/parseHeaders');\nvar isURLSameOrigin = require('./../helpers/isURLSameOrigin');\nvar createError = require('../core/createError');\n\nmodule.exports = function xhrAdapter(config) {\n return new Promise(function dispatchXhrRequest(resolve, reject) {\n var requestData = config.data;\n var requestHeaders = config.headers;\n\n if (utils.isFormData(requestData)) {\n delete requestHeaders['Content-Type']; // Let the browser set it\n }\n\n var request = new XMLHttpRequest();\n\n // HTTP basic authentication\n if (config.auth) {\n var username = config.auth.username || '';\n var password = config.auth.password || '';\n requestHeaders.Authorization = 'Basic ' + btoa(username + ':' + password);\n }\n\n var fullPath = buildFullPath(config.baseURL, config.url);\n request.open(config.method.toUpperCase(), buildURL(fullPath, config.params, config.paramsSerializer), true);\n\n // Set the request timeout in MS\n request.timeout = config.timeout;\n\n // Listen for ready state\n request.onreadystatechange = function handleLoad() {\n if (!request || request.readyState !== 4) {\n return;\n }\n\n // The request errored out and we didn't get a response, this will be\n // handled by onerror instead\n // With one exception: request that using file: protocol, most browsers\n // will return status as 0 even though it's a successful request\n if (request.status === 0 && !(request.responseURL && request.responseURL.indexOf('file:') === 0)) {\n return;\n }\n\n // Prepare the response\n var responseHeaders = 'getAllResponseHeaders' in request ? parseHeaders(request.getAllResponseHeaders()) : null;\n var responseData = !config.responseType || config.responseType === 'text' ? request.responseText : request.response;\n var response = {\n data: responseData,\n status: request.status,\n statusText: request.statusText,\n headers: responseHeaders,\n config: config,\n request: request\n };\n\n settle(resolve, reject, response);\n\n // Clean up request\n request = null;\n };\n\n // Handle browser request cancellation (as opposed to a manual cancellation)\n request.onabort = function handleAbort() {\n if (!request) {\n return;\n }\n\n reject(createError('Request aborted', config, 'ECONNABORTED', request));\n\n // Clean up request\n request = null;\n };\n\n // Handle low level network errors\n request.onerror = function handleError() {\n // Real errors are hidden from us by the browser\n // onerror should only fire if it's a network error\n reject(createError('Network Error', config, null, request));\n\n // Clean up request\n request = null;\n };\n\n // Handle timeout\n request.ontimeout = function handleTimeout() {\n var timeoutErrorMessage = 'timeout of ' + config.timeout + 'ms exceeded';\n if (config.timeoutErrorMessage) {\n timeoutErrorMessage = config.timeoutErrorMessage;\n }\n reject(createError(timeoutErrorMessage, config, 'ECONNABORTED',\n request));\n\n // Clean up request\n request = null;\n };\n\n // Add xsrf header\n // This is only done if running in a standard browser environment.\n // Specifically not if we're in a web worker, or react-native.\n if (utils.isStandardBrowserEnv()) {\n var cookies = require('./../helpers/cookies');\n\n // Add xsrf header\n var xsrfValue = (config.withCredentials || isURLSameOrigin(fullPath)) && config.xsrfCookieName ?\n cookies.read(config.xsrfCookieName) :\n undefined;\n\n if (xsrfValue) {\n requestHeaders[config.xsrfHeaderName] = xsrfValue;\n }\n }\n\n // Add headers to the request\n if ('setRequestHeader' in request) {\n utils.forEach(requestHeaders, function setRequestHeader(val, key) {\n if (typeof requestData === 'undefined' && key.toLowerCase() === 'content-type') {\n // Remove Content-Type if data is undefined\n delete requestHeaders[key];\n } else {\n // Otherwise add header to the request\n request.setRequestHeader(key, val);\n }\n });\n }\n\n // Add withCredentials to request if needed\n if (!utils.isUndefined(config.withCredentials)) {\n request.withCredentials = !!config.withCredentials;\n }\n\n // Add responseType to request if needed\n if (config.responseType) {\n try {\n request.responseType = config.responseType;\n } catch (e) {\n // Expected DOMException thrown by browsers not compatible XMLHttpRequest Level 2.\n // But, this can be suppressed for 'json' type as it can be parsed by default 'transformResponse' function.\n if (config.responseType !== 'json') {\n throw e;\n }\n }\n }\n\n // Handle progress if needed\n if (typeof config.onDownloadProgress === 'function') {\n request.addEventListener('progress', config.onDownloadProgress);\n }\n\n // Not all browsers support upload events\n if (typeof config.onUploadProgress === 'function' && request.upload) {\n request.upload.addEventListener('progress', config.onUploadProgress);\n }\n\n if (config.cancelToken) {\n // Handle cancellation\n config.cancelToken.promise.then(function onCanceled(cancel) {\n if (!request) {\n return;\n }\n\n request.abort();\n reject(cancel);\n // Clean up request\n request = null;\n });\n }\n\n if (requestData === undefined) {\n requestData = null;\n }\n\n // Send the request\n request.send(requestData);\n });\n};\n","'use strict';\n\nvar utils = require('./utils');\nvar normalizeHeaderName = require('./helpers/normalizeHeaderName');\n\nvar DEFAULT_CONTENT_TYPE = {\n 'Content-Type': 'application/x-www-form-urlencoded'\n};\n\nfunction setContentTypeIfUnset(headers, value) {\n if (!utils.isUndefined(headers) && utils.isUndefined(headers['Content-Type'])) {\n headers['Content-Type'] = value;\n }\n}\n\nfunction getDefaultAdapter() {\n var adapter;\n if (typeof XMLHttpRequest !== 'undefined') {\n // For browsers use XHR adapter\n adapter = require('./adapters/xhr');\n } else if (typeof process !== 'undefined' && Object.prototype.toString.call(process) === '[object process]') {\n // For node use HTTP adapter\n adapter = require('./adapters/http');\n }\n return adapter;\n}\n\nvar defaults = {\n adapter: getDefaultAdapter(),\n\n transformRequest: [function transformRequest(data, headers) {\n normalizeHeaderName(headers, 'Accept');\n normalizeHeaderName(headers, 'Content-Type');\n if (utils.isFormData(data) ||\n utils.isArrayBuffer(data) ||\n utils.isBuffer(data) ||\n utils.isStream(data) ||\n utils.isFile(data) ||\n utils.isBlob(data)\n ) {\n return data;\n }\n if (utils.isArrayBufferView(data)) {\n return data.buffer;\n }\n if (utils.isURLSearchParams(data)) {\n setContentTypeIfUnset(headers, 'application/x-www-form-urlencoded;charset=utf-8');\n return data.toString();\n }\n if (utils.isObject(data)) {\n setContentTypeIfUnset(headers, 'application/json;charset=utf-8');\n return JSON.stringify(data);\n }\n return data;\n }],\n\n transformResponse: [function transformResponse(data) {\n /*eslint no-param-reassign:0*/\n if (typeof data === 'string') {\n try {\n data = JSON.parse(data);\n } catch (e) { /* Ignore */ }\n }\n return data;\n }],\n\n /**\n * A timeout in milliseconds to abort a request. If set to 0 (default) a\n * timeout is not created.\n */\n timeout: 0,\n\n xsrfCookieName: 'XSRF-TOKEN',\n xsrfHeaderName: 'X-XSRF-TOKEN',\n\n maxContentLength: -1,\n\n validateStatus: function validateStatus(status) {\n return status >= 200 && status < 300;\n }\n};\n\ndefaults.headers = {\n common: {\n 'Accept': 'application/json, text/plain, */*'\n }\n};\n\nutils.forEach(['delete', 'get', 'head'], function forEachMethodNoData(method) {\n defaults.headers[method] = {};\n});\n\nutils.forEach(['post', 'put', 'patch'], function forEachMethodWithData(method) {\n defaults.headers[method] = utils.merge(DEFAULT_CONTENT_TYPE);\n});\n\nmodule.exports = defaults;\n","'use strict';\n\nvar utils = require('./../utils');\nvar transformData = require('./transformData');\nvar isCancel = require('../cancel/isCancel');\nvar defaults = require('../defaults');\n\n/**\n * Throws a `Cancel` if cancellation has been requested.\n */\nfunction throwIfCancellationRequested(config) {\n if (config.cancelToken) {\n config.cancelToken.throwIfRequested();\n }\n}\n\n/**\n * Dispatch a request to the server using the configured adapter.\n *\n * @param {object} config The config that is to be used for the request\n * @returns {Promise} The Promise to be fulfilled\n */\nmodule.exports = function dispatchRequest(config) {\n throwIfCancellationRequested(config);\n\n // Ensure headers exist\n config.headers = config.headers || {};\n\n // Transform request data\n config.data = transformData(\n config.data,\n config.headers,\n config.transformRequest\n );\n\n // Flatten headers\n config.headers = utils.merge(\n config.headers.common || {},\n config.headers[config.method] || {},\n config.headers\n );\n\n utils.forEach(\n ['delete', 'get', 'head', 'post', 'put', 'patch', 'common'],\n function cleanHeaderConfig(method) {\n delete config.headers[method];\n }\n );\n\n var adapter = config.adapter || defaults.adapter;\n\n return adapter(config).then(function onAdapterResolution(response) {\n throwIfCancellationRequested(config);\n\n // Transform response data\n response.data = transformData(\n response.data,\n response.headers,\n config.transformResponse\n );\n\n return response;\n }, function onAdapterRejection(reason) {\n if (!isCancel(reason)) {\n throwIfCancellationRequested(config);\n\n // Transform response data\n if (reason && reason.response) {\n reason.response.data = transformData(\n reason.response.data,\n reason.response.headers,\n config.transformResponse\n );\n }\n }\n\n return Promise.reject(reason);\n });\n};\n","'use strict';\n\nvar utils = require('../utils');\n\n/**\n * Config-specific merge-function which creates a new config-object\n * by merging two configuration objects together.\n *\n * @param {Object} config1\n * @param {Object} config2\n * @returns {Object} New object resulting from merging config2 to config1\n */\nmodule.exports = function mergeConfig(config1, config2) {\n // eslint-disable-next-line no-param-reassign\n config2 = config2 || {};\n var config = {};\n\n var valueFromConfig2Keys = ['url', 'method', 'params', 'data'];\n var mergeDeepPropertiesKeys = ['headers', 'auth', 'proxy'];\n var defaultToConfig2Keys = [\n 'baseURL', 'url', 'transformRequest', 'transformResponse', 'paramsSerializer',\n 'timeout', 'withCredentials', 'adapter', 'responseType', 'xsrfCookieName',\n 'xsrfHeaderName', 'onUploadProgress', 'onDownloadProgress',\n 'maxContentLength', 'validateStatus', 'maxRedirects', 'httpAgent',\n 'httpsAgent', 'cancelToken', 'socketPath'\n ];\n\n utils.forEach(valueFromConfig2Keys, function valueFromConfig2(prop) {\n if (typeof config2[prop] !== 'undefined') {\n config[prop] = config2[prop];\n }\n });\n\n utils.forEach(mergeDeepPropertiesKeys, function mergeDeepProperties(prop) {\n if (utils.isObject(config2[prop])) {\n config[prop] = utils.deepMerge(config1[prop], config2[prop]);\n } else if (typeof config2[prop] !== 'undefined') {\n config[prop] = config2[prop];\n } else if (utils.isObject(config1[prop])) {\n config[prop] = utils.deepMerge(config1[prop]);\n } else if (typeof config1[prop] !== 'undefined') {\n config[prop] = config1[prop];\n }\n });\n\n utils.forEach(defaultToConfig2Keys, function defaultToConfig2(prop) {\n if (typeof config2[prop] !== 'undefined') {\n config[prop] = config2[prop];\n } else if (typeof config1[prop] !== 'undefined') {\n config[prop] = config1[prop];\n }\n });\n\n var axiosKeys = valueFromConfig2Keys\n .concat(mergeDeepPropertiesKeys)\n .concat(defaultToConfig2Keys);\n\n var otherKeys = Object\n .keys(config2)\n .filter(function filterAxiosKeys(key) {\n return axiosKeys.indexOf(key) === -1;\n });\n\n utils.forEach(otherKeys, function otherKeysDefaultToConfig2(prop) {\n if (typeof config2[prop] !== 'undefined') {\n config[prop] = config2[prop];\n } else if (typeof config1[prop] !== 'undefined') {\n config[prop] = config1[prop];\n }\n });\n\n return config;\n};\n","'use strict';\n\nvar utils = require('./../utils');\nvar buildURL = require('../helpers/buildURL');\nvar InterceptorManager = require('./InterceptorManager');\nvar dispatchRequest = require('./dispatchRequest');\nvar mergeConfig = require('./mergeConfig');\n\n/**\n * Create a new instance of Axios\n *\n * @param {Object} instanceConfig The default config for the instance\n */\nfunction Axios(instanceConfig) {\n this.defaults = instanceConfig;\n this.interceptors = {\n request: new InterceptorManager(),\n response: new InterceptorManager()\n };\n}\n\n/**\n * Dispatch a request\n *\n * @param {Object} config The config specific for this request (merged with this.defaults)\n */\nAxios.prototype.request = function request(config) {\n /*eslint no-param-reassign:0*/\n // Allow for axios('example/url'[, config]) a la fetch API\n if (typeof config === 'string') {\n config = arguments[1] || {};\n config.url = arguments[0];\n } else {\n config = config || {};\n }\n\n config = mergeConfig(this.defaults, config);\n\n // Set config.method\n if (config.method) {\n config.method = config.method.toLowerCase();\n } else if (this.defaults.method) {\n config.method = this.defaults.method.toLowerCase();\n } else {\n config.method = 'get';\n }\n\n // Hook up interceptors middleware\n var chain = [dispatchRequest, undefined];\n var promise = Promise.resolve(config);\n\n this.interceptors.request.forEach(function unshiftRequestInterceptors(interceptor) {\n chain.unshift(interceptor.fulfilled, interceptor.rejected);\n });\n\n this.interceptors.response.forEach(function pushResponseInterceptors(interceptor) {\n chain.push(interceptor.fulfilled, interceptor.rejected);\n });\n\n while (chain.length) {\n promise = promise.then(chain.shift(), chain.shift());\n }\n\n return promise;\n};\n\nAxios.prototype.getUri = function getUri(config) {\n config = mergeConfig(this.defaults, config);\n return buildURL(config.url, config.params, config.paramsSerializer).replace(/^\\?/, '');\n};\n\n// Provide aliases for supported request methods\nutils.forEach(['delete', 'get', 'head', 'options'], function forEachMethodNoData(method) {\n /*eslint func-names:0*/\n Axios.prototype[method] = function(url, config) {\n return this.request(utils.merge(config || {}, {\n method: method,\n url: url\n }));\n };\n});\n\nutils.forEach(['post', 'put', 'patch'], function forEachMethodWithData(method) {\n /*eslint func-names:0*/\n Axios.prototype[method] = function(url, data, config) {\n return this.request(utils.merge(config || {}, {\n method: method,\n url: url,\n data: data\n }));\n };\n});\n\nmodule.exports = Axios;\n","'use strict';\n\n/**\n * A `Cancel` is an object that is thrown when an operation is canceled.\n *\n * @class\n * @param {string=} message The message.\n */\nfunction Cancel(message) {\n this.message = message;\n}\n\nCancel.prototype.toString = function toString() {\n return 'Cancel' + (this.message ? ': ' + this.message : '');\n};\n\nCancel.prototype.__CANCEL__ = true;\n\nmodule.exports = Cancel;\n","'use strict';\n\nvar Cancel = require('./Cancel');\n\n/**\n * A `CancelToken` is an object that can be used to request cancellation of an operation.\n *\n * @class\n * @param {Function} executor The executor function.\n */\nfunction CancelToken(executor) {\n if (typeof executor !== 'function') {\n throw new TypeError('executor must be a function.');\n }\n\n var resolvePromise;\n this.promise = new Promise(function promiseExecutor(resolve) {\n resolvePromise = resolve;\n });\n\n var token = this;\n executor(function cancel(message) {\n if (token.reason) {\n // Cancellation has already been requested\n return;\n }\n\n token.reason = new Cancel(message);\n resolvePromise(token.reason);\n });\n}\n\n/**\n * Throws a `Cancel` if cancellation has been requested.\n */\nCancelToken.prototype.throwIfRequested = function throwIfRequested() {\n if (this.reason) {\n throw this.reason;\n }\n};\n\n/**\n * Returns an object that contains a new `CancelToken` and a function that, when called,\n * cancels the `CancelToken`.\n */\nCancelToken.source = function source() {\n var cancel;\n var token = new CancelToken(function executor(c) {\n cancel = c;\n });\n return {\n token: token,\n cancel: cancel\n };\n};\n\nmodule.exports = CancelToken;\n","'use strict';\n\n/**\n * Syntactic sugar for invoking a function and expanding an array for arguments.\n *\n * Common use case would be to use `Function.prototype.apply`.\n *\n * ```js\n * function f(x, y, z) {}\n * var args = [1, 2, 3];\n * f.apply(null, args);\n * ```\n *\n * With `spread` this example can be re-written.\n *\n * ```js\n * spread(function(x, y, z) {})([1, 2, 3]);\n * ```\n *\n * @param {Function} callback\n * @returns {Function}\n */\nmodule.exports = function spread(callback) {\n return function wrap(arr) {\n return callback.apply(null, arr);\n };\n};\n","'use strict';\n\nvar utils = require('./utils');\nvar bind = require('./helpers/bind');\nvar Axios = require('./core/Axios');\nvar mergeConfig = require('./core/mergeConfig');\nvar defaults = require('./defaults');\n\n/**\n * Create an instance of Axios\n *\n * @param {Object} defaultConfig The default config for the instance\n * @return {Axios} A new instance of Axios\n */\nfunction createInstance(defaultConfig) {\n var context = new Axios(defaultConfig);\n var instance = bind(Axios.prototype.request, context);\n\n // Copy axios.prototype to instance\n utils.extend(instance, Axios.prototype, context);\n\n // Copy context to instance\n utils.extend(instance, context);\n\n return instance;\n}\n\n// Create the default instance to be exported\nvar axios = createInstance(defaults);\n\n// Expose Axios class to allow class inheritance\naxios.Axios = Axios;\n\n// Factory for creating new instances\naxios.create = function create(instanceConfig) {\n return createInstance(mergeConfig(axios.defaults, instanceConfig));\n};\n\n// Expose Cancel & CancelToken\naxios.Cancel = require('./cancel/Cancel');\naxios.CancelToken = require('./cancel/CancelToken');\naxios.isCancel = require('./cancel/isCancel');\n\n// Expose all/spread\naxios.all = function all(promises) {\n return Promise.all(promises);\n};\naxios.spread = require('./helpers/spread');\n\nmodule.exports = axios;\n\n// Allow use of default import syntax in TypeScript\nmodule.exports.default = axios;\n","module.exports = require('./lib/axios');","const baseURL = 'https://' + window.location.hostname // 'https://local.website.dev'\nexport const legacy = 'http://wdev.flexlink.com/myflexlink/'\n\nexport function getURL (path) {\n return `${baseURL}${path}`\n}\n\nexport function getCookie (cname) {\n const name = cname + '='\n const decodedCookie = decodeURIComponent(document.cookie)\n const ca = decodedCookie.split(';')\n for (let i = 0; i < ca.length; i++) {\n let c = ca[i]\n while (c.charAt(0) === ' ') {\n c = c.substring(1)\n }\n if (c.indexOf(name) === 0) {\n return c.substring(name.length, c.length)\n }\n }\n return ''\n}","import axios from 'axios'\nimport { getURL } from '../utils.js'\n\nexport function API () {}\n\nAPI.prototype.getURL = (path) => {\n return getURL(path)\n}\n\nAPI.prototype.Login = () => {\n window.location.href = getURL('/auth/login')\n}\n\nAPI.prototype.Logout = async () => {\n const url = getURL('/auth/logout')\n window.location.replace(url)\n}\n\nAPI.prototype.UserInfo = async () => {\n let result = {}\n const url = getURL('/auth/userinfo')\n await axios.get(url)\n .then(resp => {\n if (resp.data != null) {\n result = { claims: resp.data.IDTokenClaims }\n }\n })\n .catch(err => {\n console.log('[ERROR] GET /auth/userinfo', err.message)\n })\n return result\n}\n\nAPI.prototype.UserLocalRoles = async (username) => {\n let result = []\n let roles = {}\n if (!username) {\n return result\n }\n const path = '/ib/api/v1/settings/roles'\n const url = getURL(path)\n await axios.get(url, {withCredentials: true})\n .then(res => {\n if (res.data != null) {\n roles = res.data.roles\n Object.keys(roles).forEach(key => {\n const role = roles[key]\n if (Array.isArray(role) && role.includes(username)) {\n result.push(key)\n }\n })\n }\n })\n .catch(err => {\n console.log('[ERROR] GET ' + path, err.message)\n })\n return result\n}\n\nAPI.prototype.UploadImage = async (formData) => {\n const url = getURL('/private/upload/image/' + 'cm-instructions')\n const opt = { headers: { 'Content-Type': 'multipart/form-data' } }\n\n return axios.post(url, formData, opt)\n}\n\nAPI.prototype.DeleteImage = async (folder, filename) => {\n const url = getURL('/private/delete/image/' + encodeURIComponent(folder) + '/' + encodeURIComponent(filename))\n return axios.delete(url)\n}\n\nAPI.prototype.ssoHostURL = async () => {\n let result = {}\n const url = getURL('/about')\n await axios.get(url)\n .then(resp => {\n if (resp.data != null) {\n result = resp.data.ssoHost\n }\n })\n .catch(err => {\n console.log('[ERROR] GET /about', err.message)\n })\n return result\n}","function hasOwn(obj, key) {\n return Object.prototype.hasOwnProperty.call(obj, key);\n} // Escape special characters.\n\n\nfunction escapeRe(str) {\n return str.replace(/[.*+?^$|[\\](){}\\\\-]/g, '\\\\$&');\n} // Return a future date by the given string.\n\n\nfunction computeExpires(str) {\n var lastCh = str.charAt(str.length - 1);\n var value = parseInt(str, 10);\n var expires = new Date();\n\n switch (lastCh) {\n case 'Y':\n expires.setFullYear(expires.getFullYear() + value);\n break;\n\n case 'M':\n expires.setMonth(expires.getMonth() + value);\n break;\n\n case 'D':\n expires.setDate(expires.getDate() + value);\n break;\n\n case 'h':\n expires.setHours(expires.getHours() + value);\n break;\n\n case 'm':\n expires.setMinutes(expires.getMinutes() + value);\n break;\n\n case 's':\n expires.setSeconds(expires.getSeconds() + value);\n break;\n\n default:\n expires = new Date(str);\n }\n\n return expires;\n} // Convert an object to a cookie option string.\n\n\nfunction convert(opts) {\n var res = ''; // eslint-disable-next-line\n\n for (var key in opts) {\n if (hasOwn(opts, key)) {\n if (/^expires$/i.test(key)) {\n var expires = opts[key];\n\n if (typeof expires !== 'object') {\n expires += typeof expires === 'number' ? 'D' : '';\n expires = computeExpires(expires);\n }\n\n res += \";\" + key + \"=\" + expires.toUTCString();\n } else if (/^secure$/.test(key)) {\n if (opts[key]) {\n res += \";\" + key;\n }\n } else {\n res += \";\" + key + \"=\" + opts[key];\n }\n }\n }\n\n if (!hasOwn(opts, 'path')) {\n res += ';path=/';\n }\n\n return res;\n}\n\nexport { hasOwn, escapeRe, computeExpires, convert };","function _extends() { _extends = Object.assign || function (target) { for (var i = 1; i < arguments.length; i++) { var source = arguments[i]; for (var key in source) { if (Object.prototype.hasOwnProperty.call(source, key)) { target[key] = source[key]; } } } return target; }; return _extends.apply(this, arguments); }\n\nimport { escapeRe, convert } from './util'; // Check if the browser cookie is enabled.\n\nfunction isEnabled() {\n var key = '@key@';\n var value = '1';\n var re = new RegExp(\"(?:^|; )\" + key + \"=\" + value + \"(?:;|$)\");\n document.cookie = key + \"=\" + value + \";path=/\";\n var enabled = re.test(document.cookie);\n\n if (enabled) {\n // eslint-disable-next-line\n remove(key);\n }\n\n return enabled;\n} // Get the cookie value by key.\n\n\nfunction get(key, decoder) {\n if (decoder === void 0) {\n decoder = decodeURIComponent;\n }\n\n if (typeof key !== 'string' || !key) {\n return null;\n }\n\n var reKey = new RegExp(\"(?:^|; )\" + escapeRe(key) + \"(?:=([^;]*))?(?:;|$)\");\n var match = reKey.exec(document.cookie);\n\n if (match === null) {\n return null;\n }\n\n return typeof decoder === 'function' ? decoder(match[1]) : match[1];\n} // The all cookies\n\n\nfunction getAll(decoder) {\n if (decoder === void 0) {\n decoder = decodeURIComponent;\n }\n\n var reKey = /(?:^|; )([^=]+?)(?:=([^;]*))?(?:;|$)/g;\n var cookies = {};\n var match;\n /* eslint-disable no-cond-assign */\n\n while (match = reKey.exec(document.cookie)) {\n reKey.lastIndex = match.index + match.length - 1;\n cookies[match[1]] = typeof decoder === 'function' ? decoder(match[2]) : match[2];\n }\n\n return cookies;\n} // Set a cookie.\n\n\nfunction set(key, value, encoder, options) {\n if (encoder === void 0) {\n encoder = encodeURIComponent;\n }\n\n if (typeof encoder === 'object' && encoder !== null) {\n /* eslint-disable no-param-reassign */\n options = encoder;\n encoder = encodeURIComponent;\n /* eslint-enable no-param-reassign */\n }\n\n var attrsStr = convert(options || {});\n var valueStr = typeof encoder === 'function' ? encoder(value) : value;\n var newCookie = key + \"=\" + valueStr + attrsStr;\n document.cookie = newCookie;\n} // Remove a cookie by the specified key.\n\n\nfunction remove(key, options) {\n var opts = {\n expires: -1\n };\n\n if (options) {\n opts = _extends({}, options, opts);\n }\n\n return set(key, 'a', opts);\n} // Get the cookie's value without decoding.\n\n\nfunction getRaw(key) {\n return get(key, null);\n} // Set a cookie without encoding the value.\n\n\nfunction setRaw(key, value, options) {\n return set(key, value, null, options);\n}\n\nexport { isEnabled, get, getAll, set, getRaw, setRaw, remove, isEnabled as isCookieEnabled, get as getCookie, getAll as getAllCookies, set as setCookie, getRaw as getRawCookie, setRaw as setRawCookie, remove as removeCookie };","import { cleanUserStore, userStore } from './store'\nimport { get } from 'svelte/store'\nimport { API } from './api/api.js'\nimport { getCookie, setCookie, removeCookie} from 'tiny-cookie'\nimport { push } from 'svelte-spa-router'\n\nexport function checkLastVisited () {\n const lastVisit = getCookie('last-visit')\n console.log('[DEBUG] last-visit', lastVisit)\n if (lastVisit == null || lastVisit === '') {\n return\n }\n removeCookie('last-visit')\n push(lastVisit)\n}\n\nexport function arrayFilterByRoles (columns, roles) {\n // console.log('[DEBUG] arrayFilterByRoles', roles, columns)\n const cc = []\n for (const c of columns) {\n // console.log('[DEBUG] c.roles', c.roles)\n if (c.roles == null || roles.some(r => c.roles.includes(r))) {\n cc.push(c)\n }\n }\n return [...cc]\n}\n\nexport function objectFilterByRoles (filters, roles) {\n const ff = {}\n for (const key of Object.keys(filters)) {\n const f = filters[key]\n if (f.roles == null || roles.some(r => f.roles.includes(r))) {\n ff[key] = f\n }\n }\n return {...ff}\n}\n\n\nexport const User = function () {\n this.api = new API()\n}\n\nUser.prototype.checkAuth = async function () {\n if (getCookie('XSRF-TOKEN') === '') {\n cleanUserStore()\n return false\n }\n let localRoles = []\n const {claims} = await this.api.UserInfo()\n if (claims) {\n localRoles = await this.api.UserLocalRoles(claims.preferred_username)\n userStore.update(p => ({\n ...p,\n userInfo: claims,\n roles: [...localRoles, ...(claims?.user_roles || [])],\n username: claims.name\n }))\n return true\n }\n cleanUserStore()\n\n const user = get(userStore)\n console.log('[DEBUG] userInfo', user.userInfo)\n console.log('[DEBUG] userRoles', user.roles)\n return false\n}\n\nUser.prototype.login = function () {\n console.log('[DEBUG] login ...', )\n setCookie('last-visit', window.location.hash)\n this.api.Login()\n}\n\nUser.prototype.logout = function () {\n removeCookie('XSRF-TOKEN')\n removeCookie('auth_token')\n cleanUserStore()\n this.api.Logout()\n}\n\nUser.prototype.getUsername = function () {\n return get(userStore).username\n}\n\n","export var fl_01_small_jpg = \"data:image/jpeg;base64,/9j/4AAQSkZJRgABAQAAAQABAAD/2wBDABALDA4MChAODQ4SERATGCgaGBYWGDEjJR0oOjM9PDkzODdASFxOQERXRTc4UG1RV19iZ2hnPk1xeXBkeFxlZ2P/2wBDARESEhgVGC8aGi9jQjhCY2NjY2NjY2NjY2NjY2NjY2NjY2NjY2NjY2NjY2NjY2NjY2NjY2NjY2NjY2NjY2NjY2P/wAARCABkAYADASIAAhEBAxEB/8QAHwAAAQUBAQEBAQEAAAAAAAAAAAECAwQFBgcICQoL/8QAtRAAAgEDAwIEAwUFBAQAAAF9AQIDAAQRBRIhMUEGE1FhByJxFDKBkaEII0KxwRVS0fAkM2JyggkKFhcYGRolJicoKSo0NTY3ODk6Q0RFRkdISUpTVFVWV1hZWmNkZWZnaGlqc3R1dnd4eXqDhIWGh4iJipKTlJWWl5iZmqKjpKWmp6ipqrKztLW2t7i5usLDxMXGx8jJytLT1NXW19jZ2uHi4+Tl5ufo6erx8vP09fb3+Pn6/8QAHwEAAwEBAQEBAQEBAQAAAAAAAAECAwQFBgcICQoL/8QAtREAAgECBAQDBAcFBAQAAQJ3AAECAxEEBSExBhJBUQdhcRMiMoEIFEKRobHBCSMzUvAVYnLRChYkNOEl8RcYGRomJygpKjU2Nzg5OkNERUZHSElKU1RVVldYWVpjZGVmZ2hpanN0dXZ3eHl6goOEhYaHiImKkpOUlZaXmJmaoqOkpaanqKmqsrO0tba3uLm6wsPExcbHyMnK0tPU1dbX2Nna4uPk5ebn6Onq8vP09fb3+Pn6/9oADAMBAAIRAxEAPwDjAMmmStxikViTQVpDJoWymKkjHJqCE7eDU6EZoAliwGNSStlcVC3DDFTbcrSAhhzzU68VGPkO0dTW/p+hiaDfKSCRn6UpSSKjBy2M2MFsV1NveC1jSORAECgcdaw7a126gIM52tWjqcsaXEcbnjHOO1XTfvWJmtDbilSYbo2DL7VJWXpQSHzS0ysr4Kt0GOa1a2ZkJRilpaAG4o7U6kPSgCuP9a2evGP8/jUq9MYphyZTnOAB/WnjOOnFNiHjpSdKX+GkqRmVrrfuIk/vzKPy5/pXNaq26+C9lUV0GtN/pNqvu7fkMf1rmrpt9/K3vihgjpfDUQWxZyPvN/n+dbQFUtJi8rTol7kZNXhQMZLEJYXjyVDAjI96Za2wtoRGGLYJOT3qelAo5nawrK9xhX8KQjngfj61JwOtRNcx5xHmQ+iDP61N7FKLewvekeONxiRFb2YZotpluI96DHqD1FTEZp3uDTTszPl0qxk6wIp/2fl/lVWTw/btzHJIv45Fa+znrSgUCOck8PTLny50b/eBH+NV30m/j6R7gP7rCurxS4pAchvvbZSrxuq5zhk4o/tBzGU2KM8Er1IrrttRS2cEv+shjb6qKVkM5JZE9/yp+5D0Yfyrfk0WzfpGUP8AssarSeHkP+ruHH+8oP8AhRygZeCenNKqFmwKtPoN0p+R42H1INW4bQWqgP8AM3vUS90aVxbS0VEEko+bsKslvwpzg7RUE+Ui9zXPKTZqkkOMnyk0x5SFAHU0pQiJR61Gw3XQUfwipKLCtjApCwCknvQo5NJKuFFADIx8+atLnqDVZeGFWk6U0xM8riHNTbQahhPzYp+4h8CukzExh8VIAVYelNYgsDSsS2KAJWbawqUzYWodu5R605I2kYIR1oBalnTImnvULD5Qc12pJjtDt64rntOhEUqDGDiuojiDRYNczfNK528vJAxtGjLXjyyctmm6rBJLqYWNSzMOAK0FhMN38vQ1qW6Ly20bj1Pet6T945ai0KNlpgjsxHMBv3bsqelPeWayZUf94jHCn0rQNZ+qXC25jkwGKZbB/L+tdKZzlh7mJIvMLjHoOtEU6TAFDx39RWIlwJiWYhge3TFKJWiIeMkMOmKrlJudBQelZ1hf/aZBG64kAzx0Iq/ISEJHUDNTYohXlnIx97t9BUw6VGowoz175NSr05psBSMimmlX5lGevWkboakDB1Rt2pKP7kOfzP8A9auciHm3R/23/rW5qEn+m3j9kVV/Jc/1rK0ePzb6FeoLc0MEdvAmyFF9FAqQU0HNDuscbOx4UZNIY+jOaoC7nuIybaLvgMTweak+ySyOGmmPTG1KLBYZeXkEkTQpJucsFIXsM8/1povhHBJGFJMYwCSB24/GmXNlH50KIpJyXI3H5sf5FQQmNhPgEmWYKBjJKg//AK6zm1fQ6KcbrXUv26SRXEKFlx5XIUdhjFX6o2QY3M24EBAFUHqOp/qKvU47GdT4gxSVDPeQwA735AzgcmmRXizswjB49RyauxmWaY0ir1P5USYC5P0quXCS7WGfUluBQOxZRt348in1U3FXAHU84FPEjylgOPUE4x+XNAWJzxRkHvUMS7JGw+7dzgdj3qYjjJpAwI4rNv22j3JrTGMVlamOQaiexUNyQPut1YdutLOodEPvVGynyGibvV9PmtyD1WuZmgky4CY9ahjUeY7981NI4ZExTIu/1qLlEijAxTJ/4VFPBwCahjfzHyafQBH4dauIPlqpccBT71ajOVoQmeUpw2asKoLZqMrxwKljIxXUZjQo3VJGBkigLubNPVPmoAbgqc1oabGZpQcdKrxQl3xjNdPpdoscGSuCaznKysaU463KMh2TAjgg10VjLvhBrGvLBpX3IcGtDT0lhj2vWK0OqTvEmkcG4Aq9A6qME4zWaql7jd2q5nAJyAB14zmtqXxHLU2LhrI15EFpvx8xYD/P5VfWVwBwceh61k67cxOFiOcqQ31PpiutI5mYysVOVODT5Lp9q8fN61pSaQZbdJ4BtdlDNGf6VSh064uZ/LCFdv3iwwBVXJsWtOu1Nw0/lAOq4fBwCP8AIrdhnSdN0ZPHBBGCDUFpp0FtCY9gfd94sM5pbFNizDOR5hA4pDJokKKoPYc4qWkpR1pMY1okLq23lehBof7tOOM+9RysFXJ6DmgDkdQk+S8cfxyMP1xTvDcW6+DdlWqd2+bRAertk/zrY8Lx/wCuk+g/z+VIEdFikkRZY2RujDBp1L0OaQyhYAWb/YyMd1I6EVoHHfJqvdwGWPMZxKvKtTrScTRd9y8Nn1oGVblj9rZwWRI48Er6nJ/oKogLa21uxwZBudju6Ht/Ork5kP2oZ2eYwUAryw4XipJYo7X95vDAD/Vtjn3/AJVi9bnSm1ZIjsbmSRZGSIszuWyOnp/SrH2e5mjAml2f7vWnWCyRWCB0JfrgY7mpTI5GSUjXuSc1qtEYSd5OxVmtIo2iX52LuBn26nOP881NF5FtuS3i6nJCjjNDDzF+Uu59T0/wqUJIQBlUHoBmmIRDK5O/CDsB1qOSBA3BZj1HfFWBCmctlj6sc05kDLtHGfSgVyDcwTGFTPQd/wAqjxuJCAsR13cD8qmRAB057in7eOn50DGx8KuVAYDtT2ywIPQ01flAGfbJp/pSEAOB0rLv2DzNG3HpWrms/U4QyeZnkVMldFQ3MUh45M4P1rWtZQ8R9cVkTs2zG4il0uRhKykkiuZ7G7RoRuTJtPap0GCaqRHN0aso371hWIyST/VGobcYAJ71O3KEVB91V+tO5JJdrmBj6VJaNviB9qGG6Mj1FV9PbaWjPY0+oHAbM9qcITjIFdKukRZ5FTjSYcYxXdynPzHMxWzO2FHNWDaMhGQc10sOnxxHKgZqX7IjPlgKTgNTMOwtHMw+U49a6SOPZGBTo4UT7oqTHFcs009Tpi01oVsc1Ju4xTZODUfmVNyyZRg8VKBkckg+oqCOZVfDVIHLP04p3tqK10BebzFiAB3cCT0+orE1BEbVoo42Z33gMWPGciukiKg81zvl7/EYVBjEufy5rupy5kcc48rOkA4FLigDiiqJEbJU7SAccZqG2jMUW1jltxJ/E1NTN4yRQA+lHWm0o70AIqqGYgDJ61U1OTy7Gd/SNv5VaVQgwoAFZuvvt0yUd22r+ZoA5l4lks3kYkGIqqgdCTn+gNdF4bi26du7s36Vzcr4sgvd5ST+AH/xRrptLhvFsIowyomMg98HmpQzTaVIl3SMFA7k1Xl1CJGVUBkJOMLTY9NQJiZ2l4xycCrccSRjCIq/QU9AKge9lf5UEcZH8XWpdPs/scbAu0jMclj3qxTgaVwIrm3Fx5YPRXDH1p4t4gpURrhhg8dakopWRXM7WKt4tz8rW5yAOVBxVSG92SbZ4/nH97qK1qzNSmi80QvEGJH3j2+lRJW1TKg76NF6O5ik6Ng+hqbNc/buFJjOfbJrRt52AwDkehqFV6MqVPsXyfagEg5BwR0pkTluCOfanmtk7mTVgpDS0hoASilooAMmq184W1fI7VYNVdQGbVqT2HHdHPzkYpdOXEjN6CmSA7qs2qbLd39a5TrexNacyk1LGw881DatgZqOOXF1ismSjRL9ajbHBqPzPlamxvuT6VIWL8fKCquDHdE9jVm3OUpJ0G9T61e6uT1Ke7FOV6jpwXNd5yk6nNSAVCg2ipVagBw4NSZyKYMEUuCKUkpLUqMnEq3LYqg1wFbGeau3yO0eU61ThhjClpOWrllBxZ1wakrl23i3kO1XMA8KKz7ZmbjkLVuS6it48uwFZLzKkTA44p8NrDG7SqoLsc5PUfSqNtLJcyeYEKx9s96brGoNYWnmRths4x61vSnZ2Mqkbo1c0lckviibuoP15/wqZPFH95B+A/8Ar113OY6embSOeKwV8URd4v1xUo8S2pHIx+P/ANai4jYViegp2TjkVkr4gsz3YfgP8alXW7Nur/n/APWpgXVuIWwEkUk9BmsnxI3+ixJ3aQfoDVhLrTS4dGQMDweRWZ4iuY5ZLcI4cAMSQenSm7dCVzdTGALyQoDnJJx6fMf6AV3cYEUSJ2AAFcJomH1CEt90HcfpXcxyxS7grZ2ttPbmoSLbJqWkGD0OaWkAUdKXFFACilFNHFOoAKy9YkKCMgg8mtSs7VbR7hVaIZYcEetTJXRcHZmRHIZZgqqc+vYVr2ybUGST7ms+0iaM7XXD55BrTjyOwNYqKRpKbexajOGGanqsMkDip1bgZraOxkxcUHrS0h61QhMUUtJQAhqrfSLFaTSP0VSatGsfxHLs01lHWRgv9f6UAZ74dNynIIzU+4LYYrN0uXfC0RPK8j6VenBFrgelckla51XukxbJ9wNV538u8B96dprckGqmpybLrFRa4rmmr7oiRUcEuHK1BZzBoSvpTQSt2PepsO5uWT9RU83zJn+6apQNtIPrV6MbgR6imtrCe5RFOBpAadxXecgCnA0gpwFADgakV6jpQMUDJdoaqFzbeXJvzlfSroNK2HXawzUyXMrFQk4u6Mw3aPKsMbDPtVn7NEhDSYZveqs+kKJvOhYo/tVLUZ7mzQFsuT6DgVzypu50qqmjZlvobePkgZ4ArOv7Y3xGZSuOgxkVz/2meaYSH5mU5Ve2aspr1wPvxRn6ZFTOnNW5SVUi9yZ9JuUOY3Vvx/xqForqL/WWyMP9qIN+oqdNfQ/6yFl/3WBq3b6raXDBRIyMegcYqL1Fuh+49jLE1oeJ7NF/2kOBUUkdpE27yjJGf9ohh+uK6GSKGUYeMP8AUVVk0m2aMqoMYP8AdbP86FWQ3AqQ6dYXCBopHGe27kU5tEUfcmkH1waX+xDG2YZ+MYww6/iKDbahB9wlh/stn9DT9o+jFyLqipLpN7HzGyyD64NV3gnT5Z1nRTwSE3Y/I1pjULuE4lT/AL7TFTpq8bDEkP4g5q1VkT7OJgrCFLfZbpHx/Ccq368VYtr6/tuYy+CenX9K2WfTLoYlRM/7S1E2kWrsrW8zpjpsfOPzq41rEukQxeJbiMbJI1Prxg1ch8SxlwSrqMYPzZ/nxUEmkTkfLcgr/dZBj9KqyaVKG5ihb/cYp/StFWSIdJnQ2+uwSIMuu/uCOv5Vdj1GB1+8pPorZriX06cfdt5l+jK/+FNW1vwcJHIfY1aqRZPJJHoHmx8fMBnpTw2RxzXCrc6ta4LRS4HTjIH5U7/hIZz8sqgnOTn/ACKpNMTTR3GaTNcfH4iIOQ0ie27cP1q5D4hY9Xib2YFT/hV8l9mRz23Rp3ibbskfxAGnxVUXUI785QAFODhs9atQ1hNNOzNItNXRcj5FSZz0696ijI6VOpwvNOLGxuHPPT2pwzjrmnZoqhBSEUbgD1oyPUUAIa5rxVL/AKiIe7H+Q/rXSnB6VyGuObjWfJXqNsY/H/8AXQA630+7tbRLgbGi2byD1A61bOHtgRyDVnWglvpbKoI34QZ/z6Cl0e1WTSVMnVicE+lYcrkacyRlRsIA7enNZV+zXU4kXNb97Dbq20SZ9ahjjt0+7GzfhUKNiuYz9NR1f581deLfMp9KsbCTlLdqcIZmP+rxQ4hcWFz5hz0FakDDg1QjtnUZAzVqIsv3kNNQE5FcU4UUV0mI4U8UUUAKKdRRSAWiiigBc80kkSOPmUGiigDn9Yt44EMkI2P6iub96KKTGhSKaetFFIZ0eiXMs9syyNu2EAHvWnjNFFeXV0mzsh8KAdacKKKSGxR1qOSytpeXhXJ7gYP6UUVpEllC+0yCCEyRlwR2zkVj+Yy8hiDnFFFbx2IZZjvrmP7srfjzV22vJZnw4U++KKKllGtCB6VKUUjkCiiqjsS9yN41XpkVWlijlBEsaP8A7yg0UUPQaOS1VVi1GZI1CqCMAfSmmV9iZO7I70UV1R2Rzvc1fDTsbiZSeNoP610gdsgA4+lFFKQIm2FQCJHz9asRyO0ZyeneiiiO4PYSW4eIKQASTjmp3kYRBh1NFFay2IiVwSRkmloornNBNxHQmoJbaKSVZGQb1YMG75ooouBV1dftMsEUjNt5PB+lWJU2WcUCMyoFHQ80UU1sD3EtrWFEGFz7nmrAjReiiiikA4jFNNFFIZJH0qRRRRVIk//Z\"\nexport var icon_068_customer_service_png = \"data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAFMAAABTCAYAAADjsjsAAAAACXBIWXMAAAsTAAALEwEAmpwYAAAAAXNSR0IArs4c6QAAAARnQU1BAACxjwv8YQUAAAipSURBVHgB7VwJbFRFGP62N3dFUQ4l3CgGFBAweHAoNWIUhHiAoJB4RIiiUdTgFSMqIhgJRsEjEhFEiWIIxkRUUPEAD1RUEAQBOQW5Sqml7a7/tzPT99judne7u923dL7ka3dn3s6b+d/M/P/8888DLCwsLCwsLCwsLCwsLCzihg/eRZawobBAmC2sFP4nPAqPwivCbCDsKewj7C68UNhVmBPmWgr0d+Evwp+FX+jPFajHoKB6CV8R/g3V8wIhLBbuE+4W7ofqlYEwXC98SdgfaUQ6eiaH7QjhfVDCJCiQXcI1wpXC74V7hYeheiJ7XY7+bUthc2Fv4WVQPbmtq/y1wlnCd4WlOIlBIXKImh5FQT0vvBxqfqwN8oRXCufr8kzZfCADcRKis/B9OA3l0J0sPA3JBcubqcs391ooPB0nCdgbt0M1rASqsacgtWghnCb06/tuFQ5CipHqOfNBqEYR1LzjhD9F+Q0F3V7YCapHcZ7kfMl5k8P4H+FGzWNRyroISsF1g5o/pwqfRoaB8x+VgOkZrwmbRLiW6X2hGkkTZy/Ca+xQUrt/A9XTLxHmRyifD+Rl1++eRYZhNpzK3xXhGmplNmwTqguK0wF78mLhXOELwteFS6AUS0mY32wTPoDI8zDzKvS1TyJDQAGZBt4YJp9CnAM1RM11B4XzhDdBDfGsKPdgflt9PRXbbpz4IGbiRHPJYKKwTF83DR7H/VAVZQ+YGJKXK5wEZTuahq8WjoJaLiaCxsJhUL3ZlP0vlC0bisk6n1PQbfAoBgvLoSr6WEgel4bfwWnoKuHFSA24JP3RdS8a8aG9dJrOO5zCetQaraBWMKzg/JC84cIjOo/D8Q6kHtT+46E0v7nvMFc+rZh3dB6XsmfAQ3gTqmJUJoWu9AlwlAV7YyvULc6BWp7y/pyj3Q+yjfBPnTcbHgGHt9GSfV3prLiZ7OmEqO1yMVHwvovgDPsbXHlchpolaB94AH/AEZjBtXAEORXewItwBDrElf62TvscacZwOK6yljqNXpxSnT4T3gF7KFdDRtN31emcL4t1+tVIEzjJr9KVmKLTWgt/1WlfIXGTJ9lgfb6Eqh/raZbTpteuQpowQFfgEJxeOV2n7YFyNngRXBRQg7tHzplw5s4LkAa8BcfFRdDLbTT3UHgbN8NZLZ2t0xaj+txfJ+D8s0ffvKdOW6O/L0BmYClUfT+EGu5D4didzVBH4Lr4dji2G91cRXDW2G2RGegAtWLjsnIglLffDHUuM/ORQtCveA+c+cZNY2fW+RBJEMY1F26jjl6oyUgB6BP8zNzojKzcwIDcpoEhuc0CjX3Z5uZ8yj2QWegH7U8olHYU5RUG21Xoy3ELdbmwUSyF5cRwDc0J9rhBDX1ZmFTQGoPzmqGJT1k9mypLMeHoFhQHKllWU2QWzhLmNJW2zGvSBS2zcoOJhwKVWFZ2AAvL9uFAoILDn/6GEdEKi+Y3JMYJRxaIIOc27ohh+c2rBEl0zm6A/jlVTvRLkVkIavKi3MIqQRLSSzGmoAUeb3QW8n1BU5QrulHRCosmTJZ0Nz+MzW8RFFw45PiqtpLykFkIjszCrPADtJ90kuvzqxz33DGosX3RhMkn1z1XZDom/6TZLY0LY/NON8skGvNn1nRtNGFSofg6So/M93k5xit1aJqVjU7ZNGSCOwUta7o2mjCD47phPRWkgUtHJDTMLeKAFWYSYYWZRFhhJhFWmEmEFWYSYYWZREQTJjeesN1/HPUZuyvLzccaBRFNmMGIs/3+cmzzl6E+YoN4xXYHgjKkI3xLTddGEybDSj7mh1nHdqG+wR8IYFZpVbsZTrOnputjmTMfFZZ8XVGM6cd2irc0cEImv+/zVw2DHcgscL8c6yqqByCXiE9zhghybUVJ8CtiCEGMZV+bwfYMKihaX1nqW1l+BI1krUq327GAHwvK9uOj49ztDUr5EahgqUzCLTv9x8UJ50Nz+XtEhLi6vBjTSndiVQXjzYLDm9s1y5FEcBONUqspNLoIyQdjL9shchh3IjBbvpHI9o5GisBQkhlQsZaclbmzx/jHT+FEccSyFRILGFTFOEuzWUd+C3UUMFlYq8tdoT+bGHwGzT6MNIUattIVYcNHInFwWLl3Pg+GfJ+CxDEKTvSJ8VOayOMrkGY8BVWRzUgsfLA3nDDpV4Wn6nT2kjk6j/vbiYQAsqytuqyHdNp5qB6EljZwp28rEg8jXKLLoCkSTkG+h8QjR57TZdBuNJs883TaIngE3MUz805tToRReJv178+PcM1VOp9Rv7WZn00YpLuOnIfNqeK+8BC4x27monMRH7jZYo6htIlwTS84ceoFiA894MRIPaPTGBX3l06bBw+CWpeVYyVbx/fTqkNW10XIH63z1yA+dIMjtE+g9rcYmGvi2nnfuo65jwncFzbh2WxAPMFc5lDWVlQ3Tdhbd8AZ5jxB0SCGMju46rMOasuWcUTFrnu1h4dBAZqnzlVUrNqXB1HNvEnB0QwaB3WoNdyigSsUKo07oTRyaFwQFxIHXNczhr3U9Z29NO3aOxa0g2O7cQFPMyQWfwCDHzYi/KpkA1QYIw/9rw+TzwOq7H1cWPAE3OEI5XDE0NZMaehgssF5yH1wn/Nprxh+R+VyK1RE7wqo4KnxOFHp8MFQIz8BFaXnfhNCONI/SwVJjR5TZJtXwXOT5g0FNEPeEHZBcsEQluVwhMeV071Qw9+rMfa1Rkc4527MKmcZlH0ar5ljQAcID0othWPj8j9PzbVBHSJdcS8c5nQkXAPH8OYQ5dEROkt+gzJVdsB5ewxDUyhwmlqcU6l9+fYYDnMzD/O6D6CcMatRz0A7j0rJfbTZTTplzXuN+D9cuDS9Vz9AGeFpjaf3SkQWexaNaq5Q6LEx7+fgodbQd3TQNqTGpnuOB6TYA7nG9iPN8Hp4Gx3DocL07LvgLCwsLCwsLCwsLCwsLCxqgf8Bib+xf3D5c0sAAAAASUVORK5CYII=\"\nexport var icon_009_graduated_png = \"data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAFMAAABTCAYAAADjsjsAAAAACXBIWXMAAAsTAAALEwEAmpwYAAAAAXNSR0IArs4c6QAAAARnQU1BAACxjwv8YQUAAAi7SURBVHgB7Vt5bBzVGf/eHG9md33ESR2nJJQ0oa4aKRACadOUJqkC1LRpgIbSivJHQKSiaqtSqZAggfgHghAIEESIm4j7FoliEErEEUAQCInACJMAwcQxYIzjI7vend05+L3x2EwWO8Tsrnc2fj/r07yZfXO833zX+96YSEJCQkJCQkJCQkJCQkJCQkJCQkJCYsKBUTShq5yfrSjKnz3XPR77GiTHGNvuEW20LWsb9rMUMUSKTMMwjgdZq12iVdidOlo/PPQez/MeszlfT8lkF0UEUSCzBlp4JrRuNdrLQsdbIc+DtHewHYDEFcYWu553LvpOCfrYkM3os8HJZjeh7dEEhAIt/LlmGDeohrEfW08ISO3DdjPkNKqvrxrxzERiGk6+ROP8LfRzhs6FvI9jl5NpzqQJgaqqqapprsKgd2LwmWEiOH9PN4z/JkDUWC6n6/oCvIz1kLYQqRZkE479CV04HW3AoE+C1t2HAX4RGrSnc/4wtmeILlQIGhoSuP75uNar4ev7JHO+lsb4kqKI6sAcd2BgbmiQH2qmuRZa2EAlANzHz0DiHZCOPGI34r5LaTAzqAxAC+frpnknBpAM+ULLH4xhnE7jBxHYVuKerx1iDYbRihd8FcXjx1AkUVtbp+r6hXjYneEHh+yGNlwHX1lP5cRgsLseL/Sr0LNlIU8FvrUwN1MEKNDCkwOT6syLyM2BFkYrAIiXzvlf8Wwv5rkekQmsgYuYTeMKaBki8sWBLxxKTWzst8KELo3FYtOpAsA5/wWsZh0U4ZMQqWkc2yLcA7rUUKkALTwRN74HN+oO3TwHAu/x88LKTUM4xnQBxvBcXsBqB7HXilkZFQkJkLgaWvfOIb6Q811CC0sVkcsFWNWxGNct2qGZgHAHr4Dc5aILjRUwgRP0WOw2bdD/DfnCFOQhvK1ldPQjMUomsA/bm+lIXJlIa0DW9jwt3OFP0zA3pokIw2gEDzeFp72Btm45rGUG812hhT2YnTyqxWKLcNgkCYSjmsnBLOvlkKbeGe6SPxvw91GVMT0RUFw3QRGsG5YFiuKCmH7wYg+V2tDuGf0EXV8I7WzJS7xFEeLfokhBExEISsJPqoP+Mmzmz4jfvvd8kQbBzB/ACX3hNAj5pQhAv6WjH3qQ3L8UzJS+DUKm+bD5A8t80xDZ/z6CtrZCLsPvtXQUQeSU3DSvGUELX4J1fubHE11fRYVC07RFuODdeGP9oRuJdGkDtPV3FN31pO9DFcZwnojOIyTt64bKd4GWFofMYeDicAMXDV08JLsqqdItCst45hsPSXk4T2P7NKQpv9JfGjLDN4D/xA3680gdgG99PNDWKBY6LgBpIpfO5D33nthhAsqRkKlQAbAzmRbyPEe0fx+rpSrmXy7GPO88HBeVGeFr/1/2TIDzudDAW9VM5gOkfQ8ixfkljhrHapxONYcVsCOdTrdTASiIzDD+UV1PzQ2NdF3dDJrPE6QOutBGyA1aLtdehkq3FiTZr2mMvYun+Q9kmoLnOh0v/vYpx9Fj9bNoqVFNxUJRB6YzRkvMal/a7CxtzfTRxlQvdbs2x0BWQFtXYHAfYPsI1rzvKsmaN5YtMKhLcI8LoYF1Q4dnagadHZ9EZ4LIakWlUqBkWjITJnQxCuwXQd7IJGlzupe2ZQ6KWcMcDPIaaOvVGPgm7N/vWFYzFQZRmFgBE/4n2oN5MF5sLUg7FZp3Dkicw8de8BkrSm5ywo/8Bn5JyD5o6w4rRc8O9NDHtiWWClZCY0V1pgWDb7YZu52O3G+JSv8CT1XP8qCFwoTFQWEd8/Q4LYvV0FJYSE2JtHAkjOtK3U+grULOSUyilmwapPbS9kyKejx7LsxyruZ5l0JbXwY5dznZ7PM4JfOdi4hKv+Ocxhznfx5jJ+M8RXjnBlXzg+AfYpP8e5QDZVn2ZPg7gcd9SXouvTDQR5ugrR/ZlqhQNcFcmxCw9oKkJ0Hs+ziWVBibDuJOcXO5Jl8LGfND3FKzhs6AFv4KQc9UihZPfxDKvoYs0qmViTpf2myLHk8dgG9NUo9rz8LPa0Cs38//iCggcDaCiQhyK+ALp6plX1gcRqQW5EXEXVP7Y/pXtUM7swO0Nd1P+50sOaBSA41zoMlLjCo6xUhQFBHJrxuqEDQWQ/OEVBLK62QqCAh2nX6DsVELwpLMIwTmzGvJcRYF34GOiMr5iKncyGTabKK2w3WRmllESDKLiELJTCP/OyAae3MWVSL2OcOLrwUXXQol00J02yIa9x7sqriv879wcvRcus9vY6b1BBWIgqsAHufvimIwymw1n2IGswAJtcGi7z0EkZcdaKcObIEWZ8qUNSgJ5qgAFF5Sse1+RdP2YJp3LmqY6uvZgzRfT1CdGt1E4RWUAq/u7aB2mDisqdNhbBn19hZs5kVbUUQVfQlM5Ulc0P9KeDnmzX+LT6ZZukFRwS5rgDakuultKzl4gLEdSHf+ItIeKgKKuzxrmseh7LAOpJ4vdoWxn4j5tKhwL0aR1ihDVacTZiyK0lsz/X7ZTwDPl0UBZb1tWVdiN01FQknWulG0XegpyhVo/pECVyKKtgtQJjvJiNMcLUaNukmJEpCLahO1grS9KERvQaHkI/vbkihI7EUp76kcY9cWSxvDKOmHAyB1Hua0TWieBZNaGP4tgSA1A0XcaSihzVQ5/QjbWpArtpMVzSdavAU1lHBkySXH8yjpuj5pX0P6XIe+dmyftM+hhd1oD6BGOgQQmIYWvo6BPmPo+tPJZPIrKhHG6ysMRXxDDiJ+zRRlOUbYCMc/G4MctSSuQpNFCOOhR8whXIhwKwgdDSCvD2d04trbXM9rNnX9zVQq9SWNA8r2SUs8Hj/Gcpx5oKVRcd0ZpCg/BRPTockz2OB/9B6u6ismC91Iyfaj7260PwWJHUxVPzQ1bXeyTP/pG+Xvg3RqaOCTLGuYVLgNu6urSzhBmyQkJCQkJCQkJCQkJCQkJCQkJCQkJCSigG8AAAHyK4Ly/4sAAAAASUVORK5CYII=\"\nexport var icon_097_maintenance_service_png = \"data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAFMAAABTCAYAAADjsjsAAAAACXBIWXMAAAsTAAALEwEAmpwYAAAAAXNSR0IArs4c6QAAAARnQU1BAACxjwv8YQUAAAsXSURBVHgB7ZwLsFVVGcf/cuECVlxAlDTMPaZlgFTUVGSSCZVOktrDih5WloklMzk1zdA4mtM7x3CwbHTK3jNZgaUpleIYKJbT08xSgQsXMBoLSUQuV+5p/c5a6+59zt37nL332efccy/nP/PNea39OP/9rfX/vvWSOuiggw466GAEcJjyYZyx1xo7wdhMY93GdhrrM/YXY49p7OBo2f/6S2P7VCCONPZFY1uNlRLsgLG1xk7T6MdxxjbL/q+7jR2uAvENhaRtM7bG2LXGVhr7jrG/GTsYKXOzsekanTje2COqdJQ7jc1QQVhg7El34nXGjokp8zJj1xnb78ptMvYijS4Exh6Wvf9dxt6l8H/fbqxHBWGhsd3uxFTnKQnlZhv7pytHW/p8jQ7MMvaowvsO3PcfVeihb1WBiBJKW5JEKARuiZSbqPbG8xR6JI4QuO9xjF3u+z/KakcmcMDXjc1L+P0Mha6/QVbh40Dbs8eVW6b2RZRIHGC2+/7FCon8uyuXGavcCfDAhQllFquS0CQP/YQrgzLmDceaja9pOJG8+v+Xm0iqY5/CNoITnppQ9i2RC9KGxonSEcZ6XZkz1Z4gPub+3u0+v1yhRz6kBqKSU91J/mPsLoWELkkov1Ahoetlg/hq3Oh+X6n2xK2y93eHsQ8qJJJwb5oawPvciYgjqbobFBK6OOGYHyr05LhYzKvhBrUfyOS8UEbtfsXXtExY4U62yn1GXKKEvilSljZwZeQGPp5wzte537eqvUC76IlEwX8qG0tergY90uMKDa+SeOjdqhQliLxS9YkEcxUGwe2CQGEszGvDXhiHi9wFvlv1PYSuVUjoaoVEfqjOOae4cv3GujTyCBSKLEQWliZW41x3kT8bG1/1G0/PE4o9pdoeGUWvO+bNGlnwH7zAPKAmeaQHbQW9P3RanBTzO162UfWrdjWuc8f8RCOHqNhAZKAWwFfh62uUyRrEvlT2AQ0aO12tR5TIprWRcTjNXfQJ2QC2KPhM43G1yCscArVAbGrh++7iO1Rcr89UY39SqOyBmo9AIZFU7aaJTS3MjNwEmcBJKgZ4xR80vJurGQjUItVOgzkK25l/GVuuYnrPIfQBhX9ytopHS1U7LY41do/CcIgbRJnPN3aKsZcoH8F4ifd8HtgJKg4jotpZQBjke6HjjFFJxonmZThnNaFFeE91itgWHhmHSbKdHaSa5Ou0R3jqgEJSCX9uNDYh5Tn5s57QRkUp0AirdhFgGJTMho4C4kj+DKqdtsGPtqF5RSlQG4lNUThLdlQya8MfKL8otaXYFIVAoZcQBqX9c9Eqn1aUjlGbi00RCBQSmsVbZij00HqEVqv2mPLIagQKq18WQYgSuivhuFGj2kUiWg2zCENUlKpVPtAYUO28yNtjE009e2U7lgONQdXOiuiUmSxCAaH3yo6UjmnVzopA+UQJvFCHgGpnRaDs3nVIik1aVMeGtdq9QMPFhmq/TR3vHEJ1jBhHaKBKIinDELPvYG52f+ioAOPozIWMVt/qKs/7pPY1UPP7Q0cFLjH2jLHtsqISVXlGPRleTqPa0Th0iw5BQj8pS6TvrsPzTpT1NKYc/krZVDtL6jmmMETk2d3TS8eO6/aE4qEQSkAeHSZJq9rVhI55pfdTbkpLJx5Zum/qvNKve+aUZoWEMqGLTue8KWKRHcxtDTyyTNp7HJHe1k6ZE/VQb161fy870TRL6tloB3NujFPzgdh8iTfGI3XRpOdW/Dh1XJeuefbxOrFrsv8KIj4sO0mBIRKGl2lH0xDKKjkm5DIsPcsd1zJRavb8cjwSIrvOmzhDl05O5mPX4IAu3btFmwZZPlRuQ5k+w7gSM5EhhlUOELVT9cGF7pIVsl5jb5AdCGwqmkkmiwK+aqzLVG1dMvnougdA6LK9m7Rz8AAfmUXyellCf2fsKFmPY6JtGkJpJhie9oSekvK43GgWmVTTbxrromovT0Gkx57SM7rgyUe13RJKurhIdgEoGY8nFJIfT3G6qIf+29irZIltCppBJqrNBAWdP+koLatqI9Pgf6WDhtBH1GcJRUjmyy46wNMC2fU6eFpaQmk7ybiaSmjRAkQbWSaSqp2HSDDZ3Nb88c/xH5nvBCFUUdq+XllPu0fpRYmmgTYXz75PlXPyC0ORZNZU7bQYKJV01dM79PMDrJopT2ZgGclf3c+ICGPzeCaE4nFBitN6lSds4uGwAID14+e44xnzb5iLoqp5atWuhy/v26E1IZEXGvt2TLFAocpnESVmmDAThabIk0dG9l/ZVci9sg+OpdAQ3q8MKILMISLTqnYSPvtUn24fYN1BTSI9AoUqj6ciSmnVmvWc3DcrRlgbGeeVzJv6grEblJLURskcEpusqh0FVfvqp3d6j0R1aDKuT3EoVSCPKEXBUkRm+TEJl4b6jcbOk31IYKP7vL3eiRohkydLHKlGPDKGSGba3ZDhFPQS/UaW0CxhUy2QjuEon5ZtYwnRWMX8UK2D8pLJhdhOohxHotoTDst+qlBsaLLKVfv9xn6k7CBlZGkiopSlDa0HUlnWVL7A2D9k15QmPqg8CgaR18iJDVU7D5Fg1f7HokTSRuYhErB8GQKpisSTP5atto0CAgnH2KsDYq+tVTgrC0Nikzcg96hS7aXGblLjCGTjSKom6z6Xqxiw5IY4lU4YyF0XVyjLsrsK1f5Yg6p9y8CQRxZFJGCZDe0ae2ggRqwW2Z3+8PKM593uvqJgLj8LzRbIDqmsjjs4bTWnapc7LZY2KDZ4pAt/EJuLVRyRHgTjd7r3F2c47lOyC/gJt+J2dODBMIkXZX9W3AnSkFmRIi4vVrXThD954Jd2L0lZ/jPGvuLeU6Vv03BCIZoxKgL/+XEnqUdmoSnimsoUMUv4kxUPyj4w1L3eKhCI/JzCefh7ZZsIakw0lSNT2urez407US0y8UiW5jWs2nhkQaqdFlzsCfe+1vpOTyS4wtgFsrk/xxIdkIFFPbTPvc6MO1kSmSjWkNg0kmsjNily7aKx3xlI8szPKyTycvcetf6t7KYnntBbFBLq94KLTS+TyGQNeVnp9xjvLpWvkR0xYtMKIgFC4atkXCNPu7jCvWfd0pVVv7OeHkKp8uTvtKFw5b2qN+aciWQyKeptvLm1f7cu27ctE6EtFpskPOheXxPzG0G+33iF0Cxu3yYIZRMD34bSB+AXi90fU75mm0ksdbaxfXcc2KPLTHVNQyhEktnc1F/OuiDyA2qu2CThNvf6dg1PTrivd8r2h5IpEU7FdRizLY8n9NWy1Z1JDrGDc/WCdsavSakWbR7cf3jvYL9On9Bj7ixeiLxqrw7byPfKpnYjAVJAthRiaTfN1r1Vv7MLDpkMykxuT0cxef3DVeUIh/DKd8gOnVwt264OQ5oMiIyCBVJLthzsnwChC8ZPiVX2q0zVvrlStX+gkQU7hyGmVM+fKVR4Dwj9hWw1p/eJuJQqvLmqHO0v3otXfksF7PDKNmU84dKi7p7Sup65FTMzzpwwzc/GIB6rt5NMK4FH+jlIxyWUqbVvU9Nwhrtg6ayJ00obp55cWt9zcunc7iM8kYQMF6q9QMcvvebcH/2SSRujRvdtYq7SQrUAEFr20MXGQ8/pnh4l8iNqT1CF/Za3hE3s1/SKmHIQuk7hvk0L1ALQK1MmVGHVXqr2BpkQ4ZnfE5lXxJUQ6Huye9nRzeY3WcVWqEVAqSG03drIeqBmkdUQHpUSDMGhLzTTDq6NDqi9UlYx12v0gdSQLYaYXEsPDuknbSrTGFHzQXXQQQcddNDBaMD/AR2/9DDCtTIeAAAAAElFTkSuQmCC\"\nexport var icon_212_blockvision_inspection_png = \"data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAFMAAABRCAYAAACuepoLAAAACXBIWXMAAAsTAAALEwEAmpwYAAAAAXNSR0IArs4c6QAAAARnQU1BAACxjwv8YQUAAAwgSURBVHgB7Vx7jJxVFT/3fs+Z2WW7fdFCoUXlUYEiJKJFIq2AiNoUBJVAsSBiQhqxKqiIhviPSQOC1VCVRDAKGnlIqYZgeKo8G3lIsWkN0G2hFrptt7s7j+99/Z157bad2c7sfrOdb7u/9tvv3jvf8zfnnHvuOfeOoAmGdDo92/f9z5KmfZqUOl0RHYNmvfxxjoTYrJR6Sej6uiCXe6HYFhMETRAUSQzDG5UQy0Hi1AZOAc/0hhDiVt9x/oBySGPEhCDTtO0rIqV+huJ0risq/8V/XQgysHGbE0WlEwT/H/bqQjyrKbXcdd23aQxIOplSt6zbsP8ml7kBKkwn6jYtSU+hhWaG5ugGGWXq+lVEW3yHnnAHaW1hL+VwbJUAIXbi5GWB6z5Oo0SSyWQif4r9Sq4o/JurWfTdzpl0rn1EURJVnRM1bAOQ0rtyvXR3bjdFQx8NgtQlgeP8nUaBxJJpWNZKkHU7ioKl8TwQuGrK0ZQSsuFr8JGv+wVasWcb7VJlkynEDvRWCx3H2UpNIpFkmqZ5UiTEyyimWSI/Z3fRbVPm1JXEkcAE9AQeLd+9hXpVtQ96Cup+HlFzl9QoeZBwa+7G/mR+0xNgH3/dPReNo5eLbqnRR60MPZDvY8nkprm6YbwZBsGGZq7TuE60CQzDOBO787msgc1VXXOKvfVYwF/KAiNFyzPTK00SdvR6alJzE0dmJOUy7Cwun2t30nzDojjACn5Nx7ShLwYOP76405q4ROLItPCq53KBbeVVePmI4sNMqdNiq7NSNZSmfaGJ05NFpmVZPDQ8jssGHv1UPUVxgqXzHJBZ7XWUmriSGQoxi8oqfpxujtlW1sICwy5KPQNXP6GZcxNFJsbdR1bKR0mdWoFuTa+6OKB0SjPnJs1mVjVQE61xkZkQMUr3O1FkiigarJTfC31qBfaEAQVDoZJsM+cmikyo3zbsiiy+DTLHHDOrgTcQCKkA4bk3qQkkikyEyLZAAYtj5gIiQDyujhNsKx93BkBKVc3XUxNIms30IC5PcIFf988Y/sX5Ag4CJv/y85Uqu7BNheMSNwJChOhhKr0oPZzfS++GHsUBlsafZ3fS3qhqPDYiFPdCc9dIGMrB22K8MYR43rR3eywvsSV06b78nqqCw15yrLQps5zEqBFpprkZInolivr2KIA0BbSoHBAeDfogjcv39BT3RQjxPKTyBjocyIyCYLs0DBaiRZzO2YAeuBeEfgxpimZGRVKwV+DS1/Zspa3wDopnKjUolVoShuH71CQSSSYDhL4kDON4EHAK19mleQa5ndOMNM1C3mekAAibBRY5jl9+a+87+CLCinr7kO7LA897lkaBpCfUOgzTvBPDzK9UGviFzjDTdIk9BarfSV0I/HIbspfE6bO3QiTUnEF6oNAHxz+oEoCOjfPn14Se9ycaJSZCqtdEPujrIONW2Dq70lixn13ICWWEBk9fwSaWRjc1houvY3R1te/7r9AYkFg1H4YwCsP1hq4/CDKnoX4i8dCdSpLigrwsHPw8NkX7jrtRfxe99u3B1Klfjfr7t9EYMWFmdJQhEPP8YKjUpSD2ApB1kijN7ijl1MEtyHsXOr1BSPkX33HuR7NDMWGikTkc/G4c+7TJtrtBrkeFQj/qPAZtxbB+EnFCaKZ9ObWlhIog9Apric1eQiAMy+aQVtt1RGzfAtOYQ4ODu+scIqizcyr0eBo6oC64R13o0Q0aBdCTZ4WmDfphuJccp5dGOc2wEvvfLFR0M7WHhCol5ArszqrxmW2kUqepKLqYOHfuecfC+HVRSRjGFHtXQaB0DhxZ1vu4zmvoqB7VhXisUChspwZndlQk8znfdRZRm8Aw7XuUUJcFplmRzLRh218GiStB2Xw+hMYDSvWh119HUq728/lXD3Z4a7JSMaFDKemmUmdCfe/AtpBDOfscoJTLqQU0smqOKRYHM9GB603DLThxXgpECdGN+y6nMLxYt+3VKcNYPVjf7NQkEyOK9LW4fNORLU2XG51c7kkuw9/7QETy89SYiijL0O7PZhFQHIJwgmAlXpCnDKarByqVxwuzlDxMUfR8Ryazqb+7u0A9PWObjzBvnkzv3DnVDcOPoHYh/NNPlbWAv0CEpNSPCp63xDCMqzBS+nfNa7CaY3tmWFM36gVsgW7aTiMbjvWwKQzrflG5CMJkS0ttDW2OaWYWVJ8Jaq5blsIWlfeV8jo9lWJbOh4alcE7LMM9/zvsGRQktBfbolon1H0oIeQqXao11ECnFPC3qOi3w9sQMHhapFJnU4OS6RdytZJXpagY0S5IxrW45l/5djQ+yOF+92L/CMj7Pu7/HeJBgFI8u2sd2pYi5vn08BPqkhkJNeCVerIKhG3b86IoSnuetwX1arIE39jOGsGDgaBQeI7GjlcQo7zEcd0eOjQYBGk3Q0rXw7zcg3o3Nrar98GULUaSb3PlwMbsIkiEKj4ZKtoEt2UDyq9C3T5BrYZSrwWWdb7jOD10iAEpfQTqehGK/cUGpWbDLfsVDbPnjZCpG4r4G1mM4NWjENBfQu9mS0UPptPpo6h18LRU6hIaGNhDbQJI6D/QAV5DQ6Oyczj8V/n8oGQaRoYj2WdBif8WuIUv+m5hBWzYbbjokX4UXUCtQ+RGUT+1GSChD4GLu6jUFwj8+XFHR8dM/uygvaLSo5SImHQ1fOGMW6wrma53Hm4ww/H906mBDoiHL5Dy9X19fW1HXi34rnsL+onPoHg8tiOcMLwa+1UHJROdyEaI8ltQ8UUYhdwN/+t/SACsUJx4Ivl0vfPgk50lhVxLDQAOopvLeTy9+nVKBvogWXdCSu4gls4oYlVf3Yi/1k+atgzx7KcgY1eWlyGFUpM/8ArZjfVOCqV8FVm+64gamNwrROi5uXcoQfAN44+679+I4tGCp4umUmcclMxMJjPLD6KbVKnXqhKDLMBlhpF+wvfztfMmjrPNL/V2ExPZbK8yzWfgLl1BJX/47IN1QGkvCO+HWl8EqfwdafLjkOmTce4NSkXHkYyeMk1zPh2eUAiADJm5KPrkiJIJW8luAEYxarXvud9GKKHSmWzSrcwmKPM6JeUP4XP9nuJ/1LZPLUhNexmhO9ZWns+wYETJRKqZ12wPaiLFK2b36ZUDtxjQeBEJ6QvRGWUo1qfkeVQih/BbxZ9jNeoYtrU67rr//WpCC8M+Kk+IBTmz6o/NIzpKSERnlPhPpPldUOdTDjxErEVOlYdTMylGCCWmqn2/OxOuCM+yOJpDwFLXF3vZ7BvUImDYPBfxhheplDIe8DXtbMrnd+x/HEZmWTwXD6uP4MceQc3V9ar4PvgThN+jGgs8eRV3VC7tD123zhea+A01Bl8ofann1ScITzFN8Hpynpnhui2NGpXTH5yD11GWpOqGI0MaprF6nQOep/ISkaYeQsqeoZpEHkU1mtj3hIh5GvAhQC0yB5DCGO0wseo6BUHhBQTLFlHjSHwuu566xBEzVDR+sce2QOJmDrczJsmMEe1MZuLmQdWzmTwOH8+X4TTtPkvORGmCVaJsbi0ydWQHH8fbzKJxAvzwez3HuaVShyfJbhmTm3gyMehR7yEaEue6+JGAW4nB/drSlEDUIjMIXPdSmkTTqGczR7uk5rDGpGsUIybJjBGTZMaImjbTNDvmk6HGZw4koEXR7sK+U3ESiZp+phLBY/DwjqVxQlBKvF1HCUctMuFfylVImDX1yyljgabLpn5zrV1Rk0zfza+hcUQQz/r7Q4527oAS5+u27Zx2pHq6ZWmGGZPKia1qllBo2peklAupRQiVmsGzfUs3EzYSQVdGllVrHhT/flo1M9uWqy10y0YmUrV+/me8CCb9zBhRT82ra9pHKLcMfBOo+SAK/6TkIDqATF5yEpJYI6W4xysUHjJsew1icp7vFr5h2qmfINZ4jO84w2fPtgQIy70P07OUEpS1PIDMKNI7SYanqqg4S0NAQo6XFBWdF7TNRf//IRofjIsWxIoa64AkzZiBnvPDZrE2e3a6VGfMs6dPn95JLQae51lsvJSlrVfQ7Y/aI6De3mxpBR2wY0d+6KMeZ9eu+H45YKJBr+7Lk9zbAl5gJfE3Gip+Js/R6qM2AXjk39XYig7oJEpQUk0HiTzPsq0W75fXhPAUvvFK6sWC/wOjrqTfX/DnNwAAAABJRU5ErkJggg==\"\nexport var search_black_png = \"data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAABIAAAASCAMAAABhEH5lAAAAQlBMVEVMaXFFRURFRURFRURFRURFRURFRURFRURFRURFRURFRURFRURFRURFRURFRURFRURFRURFRURFRURFRURFRURFRUQyce/fAAAAFXRSTlMAp/OZv9UJyVSLSS7dPhXqZB93bK8C4D/yAAAAeUlEQVQYGQXBhwGDMAwAMCVkMsr0/69WAs8eOfcBwL3Hsm6jRAL4RQLuXAF7ARATjADgOBvUAoD6Qn4AUBbIFwBKgnMBQJ8wA4B23tBiAPg6sMYApGiAGcsPR4m4ANZSe+n1a1tMANv1joYjJgCANR4AAFskAABj/wPjoQRKb+id1wAAAABJRU5ErkJggg==\"\nexport var logo_png = \"data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAALoAAAA8CAYAAADR56A0AAAAGXRFWHRTb2Z0d2FyZQBBZG9iZSBJbWFnZVJlYWR5ccllPAAAEIpJREFUeNrsXQlcVFUXPzPsq+wgiKbZYmlZap9mpqVplplW5r6mkima4orlvoK44C5aZmouZaalpqVZmmVpi1qa4YagIDDsO8N3zuXO8N4swDADDN93/7/f/c3Me2/e+r/n/u+5556nKEGAgEDdRiGWC1iOYNmmUCiu6G6gIKKnLPsQso79aLGjKmxtwLVHJ/AY3BOUrs7a5cXpmaDasAeyj/8kHo2ARaB0cgSlhxs4Nn8AXF/qAA6PNCXDvQ3LRCS8Skb0hNGzIX37QbMPauNZDzxG9AbP0W+CXXCAdrk6IwtSVnwEqWt2gjo7VzwdgWqDS+e2ELBiOtg3bXgNf3ZDsv9Ly20tUqvcXcErdCB4jRsANvXctMtLiopBtXE3JC+OgeLUdPEUBKod2d/+BNefGQjBn0U3cW7/xGG0462Q7BlmEV1hbwdeYweA95ThYOPhLluXe/YC3A1dCHkX/hF3X6BGoc7Ihtt9JkLjMzub2jUKXIqLxiir3ER0aQdNft0LfgsnyEheklcAiWERcOO5YYLkArWG4rQMSJwaRV/fQqsebLJFt/XzhoCV08GtV2e9dfl/x0L8kBmQf+lfcacFah2ZB09AUWKKna2/95smWXS3ns+hFd9jkORpWz+H6+0HCpILWJ1mR3SplEVXONpjT3YGeAx9VW8ddThJqqhi9oq7KmB1yL9MzhdoUSHR7RrWhwa7osCx5cP6oj8TRf/AqZD9zRlxRwWsEihd6MOvXKI7P9saGnwSyfzjemI/NR3ieoVC7q8Xxd0UsHbYGSW6+xtdIXDzfOZC1CN5sgpuvhgC+X8JPS5g3bD19Sz9NLSSBn/8l0xCca7QlysZWXCzu3kkd33haXDp+rTJ/0vbul/b2fWeOBRsA30Nrqtsx9q5QyuTzyFlxTYoSkgC977dwan1o5LOCsC9eetAnZWj38extQHfueNkRiP/UizrwFfHteT8cA4yD5zQ/pbtH/tU9+avB3VOntH9+c0LBYWTg941M8IE+uH+hpRddm4+JM1abbRv5xseIttXSWERG0Ak2evUriUbuoeSEsg6ehoKb92xvCm/L8gw0b3DhoHf/PEG/0QXdav3eLM9K05PtWADTaYi5/tz2mO79+sOji0eNLiuMiBiVOUc0j8+yB56/oWrEIQtHtgoZUbg3oINev/xGNabkU2Km11GlLWe1XAtUqLr7p/i+JLCVxrdn+foPmy0W/eaGWF8PGXHoms2RvT60TOh3qBXZMvujl/ESO7WoxPuzAbUeflQgB1Gt1eeY+5AS5Pd8bGH2KfMveg9aahRklOtix8xE3LP/C7aQ7LI2KKlbtojbwknDGbjDFJQUJvPzBB5ZfnkEOT8WHv30Tt0EDg++Ui1HoPCQXRJrtqwG1SbP9W2DIXXboONhxtrHVPX7wLXFztY9Bzo3muuU0t0jyE9jZMcQZYq84vjguHSezJ3HRTdSy27sS5O4DNjlJ4MtPX3lnmqkmaurN0Tx1ao/vpZoLCzrZbdu3RqA/6LJ8mWkT/77pRImeEs1dBeAChnQK3WLrMUXF/uyGSjVrq4du8A7j2fN6jJWTOITQrpqupC5v5vIXHGigq3K5aQytJI23YAr3FTxe6qO/fkzfbMVRC4aW6ZTBnxGqSu2QEFsXHsIepKlnsLN0LR3eRar6QkZagFT166xbKauFEgBO2IkEm6gn9uQPygafgA1bLKVlJcDBn7joFdgwBwfrolFFy9YdFzqdenW1mnlGm43l2MblwYdxfuhMyt1ptOHbjCmwm1+uDVmVlVOof0HV+C58g3WL+DdcDQSvrOHgvxQ6Yz6y6Nx8+/fB1U6z6xmhbJZ/ooyEAjU3DFMgSjFi147wqZO5piTuLeeJfNRZAZlg/2gedbr6NGL2D3jErG599YTra4u7CQXRnRjT99NSQMD2cnKwBG+y53JyyGxqe3490ttWLkms08cBw88EFKkThpCRtJthYoHOyh/tpZcLPryFLpYNbOFFB/4xxwIC+KluVqZskL/r2lf9sKCpkury64v9aVXZ+W+OVtnLpuV612muoK8v64DCq0UFIEbV0k08AZnx6F7O9+sbpzJ8lALZLZrcOUEUiuF+QelrAIyD7+c61cl2dIH7mFNypZbsRD0uzVgsWV7ZjOXiufXKKUuB1z8iCpEn2QGmuE8gtkv/3mh8pmhJnc6cM+nu+sMXp9HpWOV6qm4NSmOTg+Lg9ZMSpd7k6OZH7zmoBrj47Q+Odd5XYAKdygOkG+4fL86jQIc7PbKOMdZVU6JL2/GqXAe3rrkpfEQGF8otUQPTnyA6bPNR4JpZsLBESHQ1zv8aYrFkcHCPpwoaxiE+ybNix1btTC3HvvycP1NbuhDbO+PgVZh76vOW+XhzvzAhgrDg83qRNWPe2j/VB4PV5eAVLSIDV6u1WdJw12pURtlRubbs8wf7bJRLe3kw0uSSWR+5sv1rw36bGHSgejKiQ61kBqhgWq1mTaNQ6SV2JvD3B5vq3VnWvy0hjm9pMiYNkUsPHxtNgx/Be9K/M61QR8UYYZcpPrSRcaFMr780rNasbCIpRJxmMvaJClukGWOO/SVeNW8FJsBc2SEgJWzTC4KiBqKsSePFtjUrBS9zyvAO6MnQ+Njm7WEoMqpX9EWJX2R88oflg4NNgRyWJcGLnq+4LPtJEo6aJr5Joo5ofiqAzB1pB+q2lk7D4MlHKjNpF56CQkTllWdY0f0lcbV6ELsvI+k0ewYCprQs7p39iQvOeoMg9FvX4vma6r1WqIHxoOWUd+gNTV28F7SlkcD40Mk6Qz5GK0JChwzD9istH1MumSe+4S5P32t9AgJoLiW3xnvSNblv7xAXkHadLQ0g6alYGsrV5H2cgIuTEkzlzFSM4M5bIPZWERpOH9IydX+3X4zQ1lk4QqRXTVJjEdrko3mbSou4v2NxmLhLfnauYrlj5wB3sIWD7N6s6dUkPQgJc5/09d9bFMwlAMkG5H19IBW7KOb/snwOudfuVuoyU66cfMfccEa029yR1aQb0BL8stHIXAYvPP4nckMoBShOgOqlgDyMOWsffrqqp9vSUkVXTDjMmqS0cqLQXy2AVuXaTn3jSq0cmlWJfTxZHHoyIUp6iMjvTaNwlmMdEVIfvkLyyYi1lpWxuW+kNGGmzCc06WjoDmX7zKBk6kk8r9lk5ikwwMTdCw1LVUBTSK6dKlrcFpkyajWA2J05dDw4Nllt3+/mDwGj8IUizcBwzcPA/sgvwNn0ZqOoupIb+6lugZddyaGxok0Ot8lTPoQ6N7VCrC9bb9tV4pz7EDwKHZ/bIHTNGMUtCsI/c+3UDp7FjaMcWH4hM+utyJD+ZeS5W4maxiCX8CY+ZZZH8k28h4kmzRgDwwFASnmcRhLijO3/WlZw1Lqpw8iHt9Atg/0KhMulCATdbhH4QOMaUDGugHvjoTKtK2YZP99zXZMhrVTV25Te6hGTdQXkGsBERCS2Z0IKsuDc2lyu6/eKJF9k0Rt75oMAyKKeRz/OBpkPvzn3KNnvvLRZHl1kTQnFrpYAjdv3vzDLsPU5DoPO1CmeQhn7uJ3o2awJ1xCyzGBQr/1cwo0hIUWzfnZ540T6a2awmBWxYYvH9E8tsDpugZbiZd8n6vWZdi5sHvoEAyN7Aw1nQfazKSSullmp4slkx4yNh9BCWI6bkhKT6fXGaUT16aU55i2aVkljWjqMcp6aV9M3kog427K4vTtvS1FOi0Krr7L+9505zNuF7jwA77LNJrln5PCJkjI1Z5oMqfe/4vi3GHxioafh6tHZTSlSvx/ScbzPXP8qNTE2Nt8RgCArpweKQpNDqy0WCYAvUxbvUKhTydSkXzVmkGmFLTOxUQsGY4tW4OjY7FGCQ5SSSWvbmclkNZqhltxZ0UsFrQ+EPDQxsMuj4zvzoJ158dzObolgcieoo0eY6AgDWB4nCC90XrRUFSIGDS7DWs71OZoD8y5X85tny4g7ilAtYElsE5aip4DH9NX6pQVoER75UrVQxZ9OMuHdtoBzQEBGq909nsfmh8arseyWlieeranXCtXX+TSK4h+g6lm0uxZ0hfcYcFatmMK8Dz7b6M5ORhkYIGf260H8hCqasS169UKBQ022CL7/tjwKnVo+JmC9SOFUdi33diK4vwlCYlJb9+wsj3zX4nlibkKww10YXgA2tYyKOAQE2BPCn+S8PoDXLaJFAEymZG4cOxLV6F9J1fmX0c29IWQ5FVUlLSGQ/6VaMjMW0oeWZKxBajI30CAuaCsnp5junHsjdL301L4b2U0i9992E23c9iqkgm9ktKaFyVskNOLSks8qRw05zT51nzoc7MEU9HwCJwfPwhRnIbSVgCxddQHHuOhZM8OXdqA17v9AeDUUVIeJou0wsLJWV8CgsFaQi3jICAgICAgICAgMD/OcKmv+cg7oKAJaC0YpKH44cKPwPFYxL4nyU6gqa4f4lFBMsLmI1KB6KjZf0PftBs1AZYvohasmCdzvrO+DELC6VWXYRlP5aZWHpguY5lBv7nGm5HcQZLsFAE/We4bAUuo5nCUVDqxqRoHUrtRLNq/XF9Nq5vg98pb/SjfP14XK6SHJvcoTR9nV5BthXX7cZllISPxgRo1CECl/2Oy8hd+gQ/DsV90jVQruRM/knLVvBjUGbQ3fi/Pfg/etvWOCztsNymQ/L9bqRrwDIYywncdi1uS0nlI/H7LfxOUaHN8ft6QbW6Y9Gf5Bb2fSwrpfoZv1NA+xf84R/EksCJQS8/2sUJeBC3s+XbeWGht8kux2WUTCUCSydeQahS0JAsZXLX5DKgDEEefN+DsPTXObdovp4q1m3cJ1UiGjdezSvc17iMxgEo2z1NQ6dsPe5YPuBkpUpBFZUynQ7jlYxeGLoZ/0fvKgni66gCNsbSB8lLM4hprKErFnrL1yrc1gk/SWr15Oc1Fks9QbO6RXTKO0aWjd4DQumZnCTrOmIhq7oSCTAHyxlOzgT8vlxCdrKSZL3pRT6a2bftOYmIEMM50XXHfimP9RnemhB0Z8bSCy1j8FjnsZyG0kGuePx+kiwyv86WWCjz0FlcRuT/A8te/E6J4Gk2sQN+Zyl98TMKCyW6oWG6tvid8ib8SgTnlVSTEFzNrfdRvm+q/JTXryeSnl4T3Y3/FqhDRD+CpRk15wB6I6qa39Ip4Xac0BpCEDSjq2QN07jFP8Wt/wxOoI1cIklBZH0Xi7G8zkSwIp3fUuTrVMzKgq5HiaSlTEGUapdemxZXwX+o1SOZR1nwr2AliBU0q0ManUsXavaTOImlZDrHyTyMe0mIIPT23Y74+3XelJOlPonlFpcN9A7vF7g1JRJfxrKQSw5di92QE0wTCKH7wp2ztC881p+81ThPEoOfixu3wrSuUjOpeJ8gnhM2jOt3ShRCrcWc8u4bEjsL/3+C9xlEaoU6aNHnc/kSwztgj0keLpH1Ld7Rm8otcwTXuZHc2vbG7agC9OaWnqx0a25pHTiB6O2uH3HtfJtXDOAVIJgff79EwmhAFYXeS/Ib6Xo8zm2uj7/h5zoEl5Hup2QoF/l/bvACfJn0LbdhvCIuwP9d4tfckcsn+v0g3+4Ul12a75pWhaTa40K2CJgFtJjKatx3iQX20RWLSE1cR6WL1QCtrLoad59oJskbcz0/RNDLevBfAQYAcOpZmfHltV0AAAAASUVORK5CYII=\"\nexport var icon_020_profile_png = \"data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAADwAAAA8CAYAAAA6/NlyAAAACXBIWXMAAAsTAAALEwEAmpwYAAAAAXNSR0IArs4c6QAAAARnQU1BAACxjwv8YQUAAAWHSURBVHgB7ZprbBRVFMf/s91XH9uWBkoplK5t0KIEVNCkrZLiCxMIfkI0QY2vxFeCCRhNQGNMNOgHE7/0k4nxTULi4wtRQYIxqI0hxZRQRFtqKtgXUPou3e34P72T2Eh2Z9o9A4Xsr/nv3e7enZ0z986555y7QJYsWbJcRVi4vCyhVlErqCj1D3WMaqZGcY2wmHqNOkPZaXSQ2gKf8XOEc6hXqNepYH0whrpQIapzolhGRa0Auicn0JEcR3NiGIcm+tE5eVE+9wf1HHUAPuCXwaXUV1Tt3aEiPB0tQzwnkvYDNv/2X+xH41gXunghyJvULiiTA33KqcMxK7Dy5bwleCa3DMWBoOuHLP5V5+RiQ6iEI59A2+TYWuetH6CItsFyvIMRBG56O78SDeEizJQIp/o6fu4cjW5NjjbwpQvUL1AiAF12UKu355XjtlAMmbCDx1gdzJenMrVvgBKaBsepXWvpmDaFS5ApAU7xnXkVCFtWHv/dDSU0DX6cKtiWWw4tygNhPBJZIE83UvOhgKbBW+s5jRfzJDVZH54noy1ebxsU0DK4mqqqCxZCm6WByNTaTeqhgJbBy+Xhei4rflBjDFZxXFoG18hDPBCBHxROzWgsgAJaBhfIQyzgRxwD5FpTpxmCAloGS9aDHgYLfjBsJ6UZggJaBh+Rh5akyjldgiQYpA0KaBl8gkqcTI5BG9u20WaO+xcU0DJYhrbpALOdcduGJocTg+ixp7KnT6GAZuDxzmnms0d4gprsHT8rTQ/1BRTQNPgb6ugbI39jyDiZjPmaxjaZCygJhIpH1DRYyhXP9tuJ0d00OlNO0VE1jnXLU3GIjVBCe+EUS0faJ8fXX7ATqGXmNJuSSi/v2ReG2tFnT0gd7H7qHJTwI1KQZD12PDla92tiCGuCBYhZ3r+maWIQz9PYs3ZC7lsx9nco4mcR7zHqvQIrp2gjM54tkflYlCaT+nFiAHvG++j0ptby36jNMAU9VfyuS8ept6iH5Z8bg7mMt6MotUIIWhYG6dx6WLBrSY6gzxTu+qmd1CfUAK5iKqiXqP1UJyXWyYIt9SqZsntgatJ5yJLlsiNljSepfTAB/SlHsj+0GfrcR52c9j3y/DvqUSofPnMzjAeV++849TH1gaNjzutfUmuQObfDXFQ5ZvO075H7vdV5/U9qJXxC6lanYTbF7sKlHl7qMNupPudkvofxzjNxRFLMfghmY03i0/PUq3AKDP9jE9XhnNMqeGQmy9LPVCVVi/Spmkz5F2GmnFykSZjw8CfqKMwFkcVW6jZyMWQf6jrqAWoZFXYM+Yh6F8aTp2IpzOjLSEuRT60CsQFm1J7CzFgHsw4fooaReqtUlqlvnb73YGY84RzjXijyIcz0ymSdlBGtgrk3G6g7YO71OMyozha5DSSleh+KiKPah7nL5zDe2xWv6aFESio1JZ+QkHSel44Bj33kYOcxd5HMSs7RdSPai8El0w46V+mFSXVdN9y8GFzmtF2Yu/Q7reumtBeDS51WrergA91O67pX68XgSqdtd+nnZ2rnFjOfcNoVLv08GSzRj0QwHWn6xGFmwC3QR9ZtcZhVafpIji3bExVwweuUdpvOsl0qW4dR6COeVzbSalz6ieNScVoLYQL0dCx32lbo0+K0btNVYm7Xnw15MbgY/3nBVEgQP+Ch32wYdI7rNl1lhBe59PFksJegQ35P2Qn/kAzL7adBUhNf6NLH8zp8xqWPnIyfkZgEPW6jJzOs2KWP5yk94tJHfo7g5zotPsRtjZV7WMVgWX/vRPooRq5+5htKqXFLDsTQB+GhcO+l4iFlGtmblVHuTdEn7pyUH05LKHbUkeJ9uaWkDCTlob1Ig9cSz63UVnhMwa4AUjL6DKYMlSVLlmuYfwGjnmLw1PRtLAAAAABJRU5ErkJggg==\"\nexport var icon_099_download_png = \"data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAADIAAAAzCAYAAADVY1sUAAAACXBIWXMAAAsTAAALEwEAmpwYAAAAAXNSR0IArs4c6QAAAARnQU1BAACxjwv8YQUAAAJySURBVHgB7ZhLaBNRGIVPYhOTIpJSpInBheDCgiiIewU3QgVx0Y0ouhIRxEUFUShUXEjxsShodOmjKoKiuFAEX7jppiIWH4i2gkiCVlOfyUyTjOd2DAyTYjOvzm29H3ww8zMhc2bu5b93AIVC8V8QcXjtZZqAHNyk5+snToKkaJEO0nGESxe9T/fUCy1wzgn6DOHSYS9EMU9QQWRDBZENFUQ2VBDZCCrIKZjLBydLIE84CTJBe+i7Jq7dSnN0lO7AHGZsdyJtdMfbDb4SA2agbvjHFXrWWghsjnREY+hpzeLG4pXYEm9fztI1+oiuQgDYV79xug3eSdUPMtE4DjHQrsQS5MqF9ff0iRGY+4g++h4+YZ+MG+jDDJ+mV3qTy7A2tqih/qLyG/2lj3hTLdVgzqN++gHOEEPrGyz7kWmDDKVWI2ju6kWcKxeQr00WeHqcnqZakz9vCBJaH9kUb+P86cTBZDadjsZOsvSaroNLQm2IYjgs5RxaGJm6jTaahUvcbHV9YYRzJVfO42nlV4WnZ+hRePgWMG2QvT+b6Xn/Zl8yg84FrQ31Qk3HQCmPB5NiiOMOzCb7Ch6xBxEfFY7wKcEj+0erWsoa5LtRxSXtE65q49AN4wlLvfQxfMIeRCxD+uCdnfjbS34wwHXtCwa1z+L4LUsH6C34TGBzRDNquMg3cKE8FeArS8foANUhAZthdv+ZGGtBRKyxxAe9w7B0ep9oWGs5eSPiZm7TNfT5DNe+rMAQfyYaXRGzgJuh1Uzv6cIso3aIsqGCyIYKIhsqiGzMmyBuOvt2mHv7MFlBh60FJ0HKdIhuhBwMQ6FQKOYsfwC1DZ2s5e/LXAAAAABJRU5ErkJggg==\"\nexport var bg_kb_red_small_png = \"data:image/jpeg;base64,/9j/4AAQSkZJRgABAQAAAQABAAD/2wBDAAYEBQYFBAYGBQYHBwYIChAKCgkJChQODwwQFxQYGBcUFhYaHSUfGhsjHBYWICwgIyYnKSopGR8tMC0oMCUoKSj/2wBDAQcHBwoIChMKChMoGhYaKCgoKCgoKCgoKCgoKCgoKCgoKCgoKCgoKCgoKCgoKCgoKCgoKCgoKCgoKCgoKCgoKCj/wAARCABnAX8DASIAAhEBAxEB/8QAHwAAAQUBAQEBAQEAAAAAAAAAAAECAwQFBgcICQoL/8QAtRAAAgEDAwIEAwUFBAQAAAF9AQIDAAQRBRIhMUEGE1FhByJxFDKBkaEII0KxwRVS0fAkM2JyggkKFhcYGRolJicoKSo0NTY3ODk6Q0RFRkdISUpTVFVWV1hZWmNkZWZnaGlqc3R1dnd4eXqDhIWGh4iJipKTlJWWl5iZmqKjpKWmp6ipqrKztLW2t7i5usLDxMXGx8jJytLT1NXW19jZ2uHi4+Tl5ufo6erx8vP09fb3+Pn6/8QAHwEAAwEBAQEBAQEBAQAAAAAAAAECAwQFBgcICQoL/8QAtREAAgECBAQDBAcFBAQAAQJ3AAECAxEEBSExBhJBUQdhcRMiMoEIFEKRobHBCSMzUvAVYnLRChYkNOEl8RcYGRomJygpKjU2Nzg5OkNERUZHSElKU1RVVldYWVpjZGVmZ2hpanN0dXZ3eHl6goOEhYaHiImKkpOUlZaXmJmaoqOkpaanqKmqsrO0tba3uLm6wsPExcbHyMnK0tPU1dbX2Nna4uPk5ebn6Onq8vP09fb3+Pn6/9oADAMBAAIRAxEAPwDg8UuKKUCvKP2KwlFFFILBRRRQAUhpaKAEopcUlMQUUUdaACiiigAoNFFAhKKKKACikpaBCUlKaSgBymn1GDg1KvIoLi7jaKVhikpDFPIqJxUlIwzTFJXRCOKnVty57ioSMGljba3tQzOLsyXp9KOc07aT9KUgKKRrYglwF55IqFQ8vT5V9ank5YZGRTiQoyeBTuZuN3qIiKg4/OhmA46mmb2f7gwPU0jMkQPOW/WgOZJabCucKSxx9Kqbys6t0XpikMxkf5vwpkzhcDuapI5qlRPVDrldzbk7ioIiy/WpFdvL9x60uNxBxyaZjL3ndDwS2MdTUoXaPfvToo9oyetDcUjdRaV2RyLuUiqTAg+9Xs1BOmfmH400zKpG6uQI21gatynIU87epxVMKScCr8Q2qB6Chk0bu6I/OB4VWP4U1g8pHy4qVTxVmFMDceppXsbRg5uzZKKdRRUHaIaSlpKYBRRRSEFFFFABRRRQAlFLSUxBSClpNu05HegBaSjODzRQIKSlpKAFooooEIaSiloEJT0bHWm0lA07E3Wm0KaUikabiUUUUCGMKj61MRTe+BTIcdR6OduD1FAYsDkYNGePlwB61FJLhTg496Cm7LUV5AvuewpAhc5k6elOhi2jc/LGpe3FAlFy1kRS/JGSOwrNck8nqea03iLKSx57egrNmBG0n0x+VOJz4m5CxwaljUONzc1E1OiYhsdjVnJF66krDmrEMe0ZPWkhjx8zdalqWzqhC2rFzTHpc80N0pGj1RDRjIpcc0UzITaAjYFBOBx3pTwDQi7iAKAt0Q+CPcc9hVljjihQEXApvU1J0xjyqxLRRRSNApKWigBtFKaSgAoNFFAgooooASiiimIKcvSm0A4oBMR1yaKcaQigGuolFFFAgpKWkoEGKWkpaAENJSmkNAgU4NSg5FQmno1BUZdB5pKWkpFsKQqMGloxmgViI5IwOlIIs9anCU/AAp3FyX3I8eppymg81GfrikVsOfc3AOF9utUrtNq8D5f5Grm4AdaiYqevzH3poyqJSVjLzk8c1bt4do3N1qRYUViwH4VJmqbOaFLld5BSZozSUja4hpRSUUyRrU0U40BS3QUE2EPINWYI9oyetJFDg5apWOOKls2pwtqxrHNOUU1Rk088Cg1S6sWiiikMKKKKACm0ppKACiiigQUGkPWimIKKKKACiiigQo9KKSjrzQO4lFLTXyOlAnoLRSA5FLQAUUUlAgNIaKSgQUgODS0qpnk9KBJPoSqcigilAxSkUjcZTlpCKQHFAiXtTWoBpcUDGAGhhxTqKAsVnBzTRxUzrULcVSMJKwpNNNGaSmQ2GaDSU5VLdBSFuJShS3SnhVB5+Y+gqQKx4Pyj0FFy1C5EI1X7xyfQVIoY9BtH609VC9BTqVzWMLCYCimdTSsc0qCge+goGBUcjYqRziq7cmhCm7KxZooopFBSUtNNMAooopABopDRTJA9aKKKACiiigApKWigApVUn6UlPjbsaGNEbZBobkVJIuRmo19KBNa2GDg0+kccUinignbQWg0tIaAGmig04Ljk/lQJK4qJnk1MFpinHXrUhPFI1SsFBFIOtOpFEbcVGTUj1FVIiTHoakBqDOKeGoCMiQ0lCnNBpFjWGagkFWaidaaM5q5Wp6oW9hT1Xn5Rk+pqQJn7xz7U7mShcjVVB4G4/pTwhP3jx6CnjjpQzBRknFI1UUgAA6DFHSozIW+4PxNAjLH5zn2oHfsSBgenNDHil4UcUw8mkMAMmn9BQoxTZDgUBsiGZ8cVGGoILNmnrHVHO7yZZoooqToENJQaKACiiigQGkpTSUxBRSiigBKKKKACiiigAo6UUUASqdwqN12mhTg1IwyKWxXxIhPNM6GpMHOBS7doz3pkWuM6HHelqGRiGBqZCCOOaBJ3dgAx9aHbb05NI7Y4HX1qJiFGTQEpW0QqttOWPWrKnIqgzEnJ6/yqe3fjB6im0TTqa2LQp1MFKDUnQI1RNUpphGaCZK5H1pVFOC07FMlRBeKf1FNpwNItCUjDIpxpKAI+lI0ir1PNK4qNUAOe9MhtrYXe7/dG0eppRGM5Y5PvS59KQmgXqPyB0o3CoWao2aiwnUsWS2aVRUERyasA4FDKi+bUdUbjNKWpM5pFNp6DVWpAKAKXFFwSsFIaKKAEooooEFFFFAAaBRRQIKKKKAAig0UUAJRRRTAKKKKBCCpk+6KKKTKjuKf1pjD1oooLIXUHrSZ2rgDBNFFNGEtNUMY7Rk1CxOeev8qKKowkxBQrlZBRRQRsXo2yBUlFFSzvg7oDzSUUUhhRRRQAUCiigBw5FJRRQMQjNRng0UUyZbDS1Rs9FFMwk2RlqTrRRTMb3HpwaeZOKKKRom0tBpcmnRtzRRQEW7lhTS5ooqTqR//Z\"\nexport var bg_oper_support_jpg = \"data:image/jpeg;base64,/9j/4AAQSkZJRgABAQAAAQABAAD/2wBDAAkGBwgHBgkICAgKCgkLDhcPDg0NDhwUFREXIh4jIyEeICAlKjUtJScyKCAgLj8vMjc5PDw8JC1CRkE6RjU7PDn/2wBDAQoKCg4MDhsPDxs5JiAmOTk5OTk5OTk5OTk5OTk5OTk5OTk5OTk5OTk5OTk5OTk5OTk5OTk5OTk5OTk5OTk5OTn/wAARCAAxAMADASIAAhEBAxEB/8QAHwAAAQUBAQEBAQEAAAAAAAAAAAECAwQFBgcICQoL/8QAtRAAAgEDAwIEAwUFBAQAAAF9AQIDAAQRBRIhMUEGE1FhByJxFDKBkaEII0KxwRVS0fAkM2JyggkKFhcYGRolJicoKSo0NTY3ODk6Q0RFRkdISUpTVFVWV1hZWmNkZWZnaGlqc3R1dnd4eXqDhIWGh4iJipKTlJWWl5iZmqKjpKWmp6ipqrKztLW2t7i5usLDxMXGx8jJytLT1NXW19jZ2uHi4+Tl5ufo6erx8vP09fb3+Pn6/8QAHwEAAwEBAQEBAQEBAQAAAAAAAAECAwQFBgcICQoL/8QAtREAAgECBAQDBAcFBAQAAQJ3AAECAxEEBSExBhJBUQdhcRMiMoEIFEKRobHBCSMzUvAVYnLRChYkNOEl8RcYGRomJygpKjU2Nzg5OkNERUZHSElKU1RVVldYWVpjZGVmZ2hpanN0dXZ3eHl6goOEhYaHiImKkpOUlZaXmJmaoqOkpaanqKmqsrO0tba3uLm6wsPExcbHyMnK0tPU1dbX2Nna4uPk5ebn6Onq8vP09fb3+Pn6/9oADAMBAAIRAxEAPwCvRRRVkhRRRQAGmHNPNNIoAafc03OKcR7Un4UAKOaUGmZPrTgc0AONNpRzxSGgAZjt9cUxyCg5HJ6UDO48UvlgEN2FAEiDC0x2yaQuTTc5oACaTpSE4pM0AK3IqEjBqTNNfkUgGVZiPFVqsQqcZpgTU00tIaAJaKKKACiiigBDSUtJQAEZpjDFPpKAI6QEinsvpUZXIxQBIDml6j3qIKVPBpwJoANzelLuOOaVhmkOB3NADSKQkDuKbKeOOMVCWoAlJHc0wt6UzOaesbHrwKQBmlUFzgcD1qURKpx1p4GOgpgIkca9fmNScY4pg60+gBBSGgUGgCWiiigAooooASmk4pxqM0AOyKKZSqc0AOpCM0UmecUAMOQelJ89SAcmg5HSgCIlgec0malIDDnrVdso2CKAHHmo2jxzmnhhQxzSAemMcCnVGpxT80wHn7w+lOIphPzL9KkoAaaWg0UABppp1NNAE1FFFABRRRQA0000UUANPSiPrRRQA6k/ioooAUdTRRRQA1ulRT/w0UUARCnGiikAo606iigB56rUtFFMBDTRRRQAppKKKAP/2Q==\"","\n\n\n
\n
\n {#each links as link}\n {link.title}\n {/each}\n
\n
\n {#each social as s}\n {s.alt}/\n {/each}\n
\n
\n\n
\n\n
\n
push('/')}>\n \"FlexLink\n
\n\n
\n {#each mainMenuItems as item}\n
mainItemClick(item)}>\n {item.title.toUpperCase()}\n
\n {/each}\n\n {#if is($userStore.roles, 'ib_admin', 'admin')}\n {#each adminMenu as item}\n
push(item.ref)}>\n {item.title.toUpperCase()}\n
\n {/each}\n {/if}\n
\n\n
\n {#await checking then value}\n {#if $userStore.username == null && $location !== '/login' }\n
\n sign in\n \"\"\n
\n {/if}\n {#if $userStore.username != null && $location !== '/login' }\n
\n {getName()}\n \"\"\n
\n {/if}\n {/await}\n
\n
\n\n {#if showSubMenu}\n
\n {#each subMenuItems as item}\n
subMenuClick(item)}>\n {item.title}\n
\n {/each}\n
\n {/if}\n
\n\n\n\n","\n\n
\n {#if !active || ref.length <= 3}\n
\n  \n
\n {/if}\n\n
\n {#if pic != null}\n
\n \"{pic}\"\n
\n {/if}\n\n
\n
{title}
\n
{details}
\n \n\n
\n \n
\n\n
\n \n
\n\n
\n
\n
\n\n","\n\n
\n
\n
\n \"{pic}\"\n {title}\n
\n
\n
\n","export function filterExtraApplications(ids, applications){\n return applications.filter(app => !ids.includes(app.id))\n}\n\nexport function getUrl(app){\n if([2101, 2102, 2104].includes(app.id)){ // IB, CM, Spare parts\n return \"#\" + app.rootUrl.substring(app.rootUrl.lastIndexOf('/'));\n }\n return app.rootUrl\n}\n\nexport function getType(app){\n if([2101, 2102, 2104].includes(app.id)){ // IB, CM, Spare parts\n return 'component'\n }\n if (!app.externalSite || app.showInSameTab) {\n return 'same-tab'\n }\n return 'external'\n}","\n\n
\n
\n\n
\n
\n Apps & Downloads\n
\n
\n {#if $userStore.username && $userStore.username !== \"\"}\n

\n MyFlexLink offers a variety of applications to simplify and enhance your product and software experience.\n In our Online Store you can search for product information,\n order components, configure conveyors\n and keep track of your orders. The Installed Base and the\n Conveyor Condition Monitoring\n will help to keep an overview of all your systems and upcoming maintenance needs.\n

\n

\n Whether you are looking for spare parts for a drive unit, ordering information,\n or how to assemble a conveyor, you can find it in the Technical Library.\n Under Software Download, you will be able to find the FlexLink engineering software suite\n to design your conveyor. Lastly, the CAD Files Download offer native files\n for most parts of our components.\n

\n {:else}\n

\n Sign In for more applications.\n \n Please be aware that some applications will show a limited result if you are not signed in.\n \n

\n

\n Don't have a My FlexLink account? Sign Up here.\n

\n

Forgot your password?

\n {/if}\n
\n
\n\n
\n {#each applicationItems as app}\n \n {/each}\n
\n
\n\n {#if extraApplications.length!==0}\n
\n\n
\n
\n More applications\n
\n
\n\n
\n
\n {#each extraApplications as app}\n \n {/each}\n
\n
\n\n
\n {/if}\n\n
\n\n","\n\n\n
\n
\n
 \n
\n\n \"small\"\n\n\n (loaded = true)}\n />\n
\n
\n\n\n\n\n","\n\n
\n \n\n dispatch('search', searchText)}\n >
\n
\n\n","import { getURL } from './utils'\n\nconst Tracker = function () {}\n\nTracker.prototype.track = function (tag) {\n const message = {\n tag: tag,\n path: window.location.pathname,\n hash: window.location.hash,\n site: \"alpha.my.flexlink.io\"\n }\n fetch(getURL('/api/v1/tracking'), {\n method: 'POST',\n credentials: 'same-origin',\n headers: {'Content-Type': 'application/json'},\n body: JSON.stringify(message)\n })\n}\n\nTracker.prototype.init = function () {\n const callback = this.track;\n document.addEventListener('click', function (event) {\n const attr = 'data-tracking'\n let elem = event.target\n let level = 0\n let iter = 0\n let attribute = null\n while (elem && iter < 100) {\n iter += 1\n attribute = elem.getAttribute(attr)\n if (!attribute || attribute === '') {\n level += 1\n elem = elem.parentElement\n continue\n }\n break\n }\n if (!elem || !attribute || attribute === '') {\n return\n }\n callback(attribute);\n })\n}\n\nexport default Tracker;","\n\n
\n \n\n
\n\n
\n\n
\n Knowledge Base & Technical Support\n
\n\n
\n search({key: 'Enter'})} />\n
\n
\n\n
\n {#each applications as app}\n {#if !app.internal || app.internal && is($userStore.roles, 'internal')}\n \n {/if}\n {/each}\n\n
\n\n
\n
\n\n\n","\n\n
\n \n\n
\n\n
a.visible).length < 2 ? ' justify-center' : '')}\n style=\"max-width: 640px;\">\n {#each applications as app}\n {#if app.visible}\n \n {/if}\n {/each}\n\n
\n\n
\n\n
\n Operations Support\n
\n\n
\n\n\n
\n
\n\n\n","\n\n
\n \n
\n
Welcome to My FlexLink
\n
How can we help you today?
\n
\n
\n\n \n\n \n\n {#if is($userStore.roles, 'internal')}\n
\n \n
\n {/if}\n\n \n
\n\n\n","\n\n
\n\n
\n\n
\n {#each menuLinks as link}\n \n {/each}\n
\n\n
\n\n
\n
\n {#each links as link}\n \n {/each}\n
\n\n
\n Follow us\n
\n {#each social as s}\n {s.alt}\n {/each}\n
\n
\n
\n\n
\n\n
\n
© FlexLink {year} - All rights reserved -
\n {#each bottomLinks as bl}\n \n {/each}\n
\n\n
\n
Portal: {version}
\n
Installed base: {ib_version}
\n
\n\n
\n\n\n","/* @preserve\n * Leaflet 1.7.1, a JS library for interactive maps. http://leafletjs.com\n * (c) 2010-2019 Vladimir Agafonkin, (c) 2010-2011 CloudMade\n */\n\n(function (global, factory) {\n typeof exports === 'object' && typeof module !== 'undefined' ? factory(exports) :\n typeof define === 'function' && define.amd ? define(['exports'], factory) :\n (factory((global.L = {})));\n}(this, (function (exports) { 'use strict';\n\n var version = \"1.7.1\";\n\n /*\r\n * @namespace Util\r\n *\r\n * Various utility functions, used by Leaflet internally.\r\n */\r\n\r\n // @function extend(dest: Object, src?: Object): Object\r\n // Merges the properties of the `src` object (or multiple objects) into `dest` object and returns the latter. Has an `L.extend` shortcut.\r\n function extend(dest) {\r\n \tvar i, j, len, src;\r\n\r\n \tfor (j = 1, len = arguments.length; j < len; j++) {\r\n \t\tsrc = arguments[j];\r\n \t\tfor (i in src) {\r\n \t\t\tdest[i] = src[i];\r\n \t\t}\r\n \t}\r\n \treturn dest;\r\n }\r\n\r\n // @function create(proto: Object, properties?: Object): Object\r\n // Compatibility polyfill for [Object.create](https://developer.mozilla.org/docs/Web/JavaScript/Reference/Global_Objects/Object/create)\r\n var create = Object.create || (function () {\r\n \tfunction F() {}\r\n \treturn function (proto) {\r\n \t\tF.prototype = proto;\r\n \t\treturn new F();\r\n \t};\r\n })();\r\n\r\n // @function bind(fn: Function, …): Function\r\n // Returns a new function bound to the arguments passed, like [Function.prototype.bind](https://developer.mozilla.org/docs/Web/JavaScript/Reference/Global_Objects/Function/bind).\r\n // Has a `L.bind()` shortcut.\r\n function bind(fn, obj) {\r\n \tvar slice = Array.prototype.slice;\r\n\r\n \tif (fn.bind) {\r\n \t\treturn fn.bind.apply(fn, slice.call(arguments, 1));\r\n \t}\r\n\r\n \tvar args = slice.call(arguments, 2);\r\n\r\n \treturn function () {\r\n \t\treturn fn.apply(obj, args.length ? args.concat(slice.call(arguments)) : arguments);\r\n \t};\r\n }\r\n\r\n // @property lastId: Number\r\n // Last unique ID used by [`stamp()`](#util-stamp)\r\n var lastId = 0;\r\n\r\n // @function stamp(obj: Object): Number\r\n // Returns the unique ID of an object, assigning it one if it doesn't have it.\r\n function stamp(obj) {\r\n \t/*eslint-disable */\r\n \tobj._leaflet_id = obj._leaflet_id || ++lastId;\r\n \treturn obj._leaflet_id;\r\n \t/* eslint-enable */\r\n }\r\n\r\n // @function throttle(fn: Function, time: Number, context: Object): Function\r\n // Returns a function which executes function `fn` with the given scope `context`\r\n // (so that the `this` keyword refers to `context` inside `fn`'s code). The function\r\n // `fn` will be called no more than one time per given amount of `time`. The arguments\r\n // received by the bound function will be any arguments passed when binding the\r\n // function, followed by any arguments passed when invoking the bound function.\r\n // Has an `L.throttle` shortcut.\r\n function throttle(fn, time, context) {\r\n \tvar lock, args, wrapperFn, later;\r\n\r\n \tlater = function () {\r\n \t\t// reset lock and call if queued\r\n \t\tlock = false;\r\n \t\tif (args) {\r\n \t\t\twrapperFn.apply(context, args);\r\n \t\t\targs = false;\r\n \t\t}\r\n \t};\r\n\r\n \twrapperFn = function () {\r\n \t\tif (lock) {\r\n \t\t\t// called too soon, queue to call later\r\n \t\t\targs = arguments;\r\n\r\n \t\t} else {\r\n \t\t\t// call and lock until later\r\n \t\t\tfn.apply(context, arguments);\r\n \t\t\tsetTimeout(later, time);\r\n \t\t\tlock = true;\r\n \t\t}\r\n \t};\r\n\r\n \treturn wrapperFn;\r\n }\r\n\r\n // @function wrapNum(num: Number, range: Number[], includeMax?: Boolean): Number\r\n // Returns the number `num` modulo `range` in such a way so it lies within\r\n // `range[0]` and `range[1]`. The returned value will be always smaller than\r\n // `range[1]` unless `includeMax` is set to `true`.\r\n function wrapNum(x, range, includeMax) {\r\n \tvar max = range[1],\r\n \t min = range[0],\r\n \t d = max - min;\r\n \treturn x === max && includeMax ? x : ((x - min) % d + d) % d + min;\r\n }\r\n\r\n // @function falseFn(): Function\r\n // Returns a function which always returns `false`.\r\n function falseFn() { return false; }\r\n\r\n // @function formatNum(num: Number, digits?: Number): Number\r\n // Returns the number `num` rounded to `digits` decimals, or to 6 decimals by default.\r\n function formatNum(num, digits) {\r\n \tvar pow = Math.pow(10, (digits === undefined ? 6 : digits));\r\n \treturn Math.round(num * pow) / pow;\r\n }\r\n\r\n // @function trim(str: String): String\r\n // Compatibility polyfill for [String.prototype.trim](https://developer.mozilla.org/docs/Web/JavaScript/Reference/Global_Objects/String/Trim)\r\n function trim(str) {\r\n \treturn str.trim ? str.trim() : str.replace(/^\\s+|\\s+$/g, '');\r\n }\r\n\r\n // @function splitWords(str: String): String[]\r\n // Trims and splits the string on whitespace and returns the array of parts.\r\n function splitWords(str) {\r\n \treturn trim(str).split(/\\s+/);\r\n }\r\n\r\n // @function setOptions(obj: Object, options: Object): Object\r\n // Merges the given properties to the `options` of the `obj` object, returning the resulting options. See `Class options`. Has an `L.setOptions` shortcut.\r\n function setOptions(obj, options) {\r\n \tif (!Object.prototype.hasOwnProperty.call(obj, 'options')) {\r\n \t\tobj.options = obj.options ? create(obj.options) : {};\r\n \t}\r\n \tfor (var i in options) {\r\n \t\tobj.options[i] = options[i];\r\n \t}\r\n \treturn obj.options;\r\n }\r\n\r\n // @function getParamString(obj: Object, existingUrl?: String, uppercase?: Boolean): String\r\n // Converts an object into a parameter URL string, e.g. `{a: \"foo\", b: \"bar\"}`\r\n // translates to `'?a=foo&b=bar'`. If `existingUrl` is set, the parameters will\r\n // be appended at the end. If `uppercase` is `true`, the parameter names will\r\n // be uppercased (e.g. `'?A=foo&B=bar'`)\r\n function getParamString(obj, existingUrl, uppercase) {\r\n \tvar params = [];\r\n \tfor (var i in obj) {\r\n \t\tparams.push(encodeURIComponent(uppercase ? i.toUpperCase() : i) + '=' + encodeURIComponent(obj[i]));\r\n \t}\r\n \treturn ((!existingUrl || existingUrl.indexOf('?') === -1) ? '?' : '&') + params.join('&');\r\n }\r\n\r\n var templateRe = /\\{ *([\\w_-]+) *\\}/g;\r\n\r\n // @function template(str: String, data: Object): String\r\n // Simple templating facility, accepts a template string of the form `'Hello {a}, {b}'`\r\n // and a data object like `{a: 'foo', b: 'bar'}`, returns evaluated string\r\n // `('Hello foo, bar')`. You can also specify functions instead of strings for\r\n // data values — they will be evaluated passing `data` as an argument.\r\n function template(str, data) {\r\n \treturn str.replace(templateRe, function (str, key) {\r\n \t\tvar value = data[key];\r\n\r\n \t\tif (value === undefined) {\r\n \t\t\tthrow new Error('No value provided for variable ' + str);\r\n\r\n \t\t} else if (typeof value === 'function') {\r\n \t\t\tvalue = value(data);\r\n \t\t}\r\n \t\treturn value;\r\n \t});\r\n }\r\n\r\n // @function isArray(obj): Boolean\r\n // Compatibility polyfill for [Array.isArray](https://developer.mozilla.org/docs/Web/JavaScript/Reference/Global_Objects/Array/isArray)\r\n var isArray = Array.isArray || function (obj) {\r\n \treturn (Object.prototype.toString.call(obj) === '[object Array]');\r\n };\r\n\r\n // @function indexOf(array: Array, el: Object): Number\r\n // Compatibility polyfill for [Array.prototype.indexOf](https://developer.mozilla.org/docs/Web/JavaScript/Reference/Global_Objects/Array/indexOf)\r\n function indexOf(array, el) {\r\n \tfor (var i = 0; i < array.length; i++) {\r\n \t\tif (array[i] === el) { return i; }\r\n \t}\r\n \treturn -1;\r\n }\r\n\r\n // @property emptyImageUrl: String\r\n // Data URI string containing a base64-encoded empty GIF image.\r\n // Used as a hack to free memory from unused images on WebKit-powered\r\n // mobile devices (by setting image `src` to this string).\r\n var emptyImageUrl = 'data:image/gif;base64,R0lGODlhAQABAAD/ACwAAAAAAQABAAACADs=';\r\n\r\n // inspired by http://paulirish.com/2011/requestanimationframe-for-smart-animating/\r\n\r\n function getPrefixed(name) {\r\n \treturn window['webkit' + name] || window['moz' + name] || window['ms' + name];\r\n }\r\n\r\n var lastTime = 0;\r\n\r\n // fallback for IE 7-8\r\n function timeoutDefer(fn) {\r\n \tvar time = +new Date(),\r\n \t timeToCall = Math.max(0, 16 - (time - lastTime));\r\n\r\n \tlastTime = time + timeToCall;\r\n \treturn window.setTimeout(fn, timeToCall);\r\n }\r\n\r\n var requestFn = window.requestAnimationFrame || getPrefixed('RequestAnimationFrame') || timeoutDefer;\r\n var cancelFn = window.cancelAnimationFrame || getPrefixed('CancelAnimationFrame') ||\r\n \t\tgetPrefixed('CancelRequestAnimationFrame') || function (id) { window.clearTimeout(id); };\r\n\r\n // @function requestAnimFrame(fn: Function, context?: Object, immediate?: Boolean): Number\r\n // Schedules `fn` to be executed when the browser repaints. `fn` is bound to\r\n // `context` if given. When `immediate` is set, `fn` is called immediately if\r\n // the browser doesn't have native support for\r\n // [`window.requestAnimationFrame`](https://developer.mozilla.org/docs/Web/API/window/requestAnimationFrame),\r\n // otherwise it's delayed. Returns a request ID that can be used to cancel the request.\r\n function requestAnimFrame(fn, context, immediate) {\r\n \tif (immediate && requestFn === timeoutDefer) {\r\n \t\tfn.call(context);\r\n \t} else {\r\n \t\treturn requestFn.call(window, bind(fn, context));\r\n \t}\r\n }\r\n\r\n // @function cancelAnimFrame(id: Number): undefined\r\n // Cancels a previous `requestAnimFrame`. See also [window.cancelAnimationFrame](https://developer.mozilla.org/docs/Web/API/window/cancelAnimationFrame).\r\n function cancelAnimFrame(id) {\r\n \tif (id) {\r\n \t\tcancelFn.call(window, id);\r\n \t}\r\n }\n\n var Util = ({\n extend: extend,\n create: create,\n bind: bind,\n lastId: lastId,\n stamp: stamp,\n throttle: throttle,\n wrapNum: wrapNum,\n falseFn: falseFn,\n formatNum: formatNum,\n trim: trim,\n splitWords: splitWords,\n setOptions: setOptions,\n getParamString: getParamString,\n template: template,\n isArray: isArray,\n indexOf: indexOf,\n emptyImageUrl: emptyImageUrl,\n requestFn: requestFn,\n cancelFn: cancelFn,\n requestAnimFrame: requestAnimFrame,\n cancelAnimFrame: cancelAnimFrame\n });\n\n // @class Class\r\n // @aka L.Class\r\n\r\n // @section\r\n // @uninheritable\r\n\r\n // Thanks to John Resig and Dean Edwards for inspiration!\r\n\r\n function Class() {}\r\n\r\n Class.extend = function (props) {\r\n\r\n \t// @function extend(props: Object): Function\r\n \t// [Extends the current class](#class-inheritance) given the properties to be included.\r\n \t// Returns a Javascript function that is a class constructor (to be called with `new`).\r\n \tvar NewClass = function () {\r\n\r\n \t\t// call the constructor\r\n \t\tif (this.initialize) {\r\n \t\t\tthis.initialize.apply(this, arguments);\r\n \t\t}\r\n\r\n \t\t// call all constructor hooks\r\n \t\tthis.callInitHooks();\r\n \t};\r\n\r\n \tvar parentProto = NewClass.__super__ = this.prototype;\r\n\r\n \tvar proto = create(parentProto);\r\n \tproto.constructor = NewClass;\r\n\r\n \tNewClass.prototype = proto;\r\n\r\n \t// inherit parent's statics\r\n \tfor (var i in this) {\r\n \t\tif (Object.prototype.hasOwnProperty.call(this, i) && i !== 'prototype' && i !== '__super__') {\r\n \t\t\tNewClass[i] = this[i];\r\n \t\t}\r\n \t}\r\n\r\n \t// mix static properties into the class\r\n \tif (props.statics) {\r\n \t\textend(NewClass, props.statics);\r\n \t\tdelete props.statics;\r\n \t}\r\n\r\n \t// mix includes into the prototype\r\n \tif (props.includes) {\r\n \t\tcheckDeprecatedMixinEvents(props.includes);\r\n \t\textend.apply(null, [proto].concat(props.includes));\r\n \t\tdelete props.includes;\r\n \t}\r\n\r\n \t// merge options\r\n \tif (proto.options) {\r\n \t\tprops.options = extend(create(proto.options), props.options);\r\n \t}\r\n\r\n \t// mix given properties into the prototype\r\n \textend(proto, props);\r\n\r\n \tproto._initHooks = [];\r\n\r\n \t// add method for calling all hooks\r\n \tproto.callInitHooks = function () {\r\n\r\n \t\tif (this._initHooksCalled) { return; }\r\n\r\n \t\tif (parentProto.callInitHooks) {\r\n \t\t\tparentProto.callInitHooks.call(this);\r\n \t\t}\r\n\r\n \t\tthis._initHooksCalled = true;\r\n\r\n \t\tfor (var i = 0, len = proto._initHooks.length; i < len; i++) {\r\n \t\t\tproto._initHooks[i].call(this);\r\n \t\t}\r\n \t};\r\n\r\n \treturn NewClass;\r\n };\r\n\r\n\r\n // @function include(properties: Object): this\r\n // [Includes a mixin](#class-includes) into the current class.\r\n Class.include = function (props) {\r\n \textend(this.prototype, props);\r\n \treturn this;\r\n };\r\n\r\n // @function mergeOptions(options: Object): this\r\n // [Merges `options`](#class-options) into the defaults of the class.\r\n Class.mergeOptions = function (options) {\r\n \textend(this.prototype.options, options);\r\n \treturn this;\r\n };\r\n\r\n // @function addInitHook(fn: Function): this\r\n // Adds a [constructor hook](#class-constructor-hooks) to the class.\r\n Class.addInitHook = function (fn) { // (Function) || (String, args...)\r\n \tvar args = Array.prototype.slice.call(arguments, 1);\r\n\r\n \tvar init = typeof fn === 'function' ? fn : function () {\r\n \t\tthis[fn].apply(this, args);\r\n \t};\r\n\r\n \tthis.prototype._initHooks = this.prototype._initHooks || [];\r\n \tthis.prototype._initHooks.push(init);\r\n \treturn this;\r\n };\r\n\r\n function checkDeprecatedMixinEvents(includes) {\r\n \tif (typeof L === 'undefined' || !L || !L.Mixin) { return; }\r\n\r\n \tincludes = isArray(includes) ? includes : [includes];\r\n\r\n \tfor (var i = 0; i < includes.length; i++) {\r\n \t\tif (includes[i] === L.Mixin.Events) {\r\n \t\t\tconsole.warn('Deprecated include of L.Mixin.Events: ' +\r\n \t\t\t\t'this property will be removed in future releases, ' +\r\n \t\t\t\t'please inherit from L.Evented instead.', new Error().stack);\r\n \t\t}\r\n \t}\r\n }\n\n /*\r\n * @class Evented\r\n * @aka L.Evented\r\n * @inherits Class\r\n *\r\n * A set of methods shared between event-powered classes (like `Map` and `Marker`). Generally, events allow you to execute some function when something happens with an object (e.g. the user clicks on the map, causing the map to fire `'click'` event).\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * map.on('click', function(e) {\r\n * \talert(e.latlng);\r\n * } );\r\n * ```\r\n *\r\n * Leaflet deals with event listeners by reference, so if you want to add a listener and then remove it, define it as a function:\r\n *\r\n * ```js\r\n * function onClick(e) { ... }\r\n *\r\n * map.on('click', onClick);\r\n * map.off('click', onClick);\r\n * ```\r\n */\r\n\r\n var Events = {\r\n \t/* @method on(type: String, fn: Function, context?: Object): this\r\n \t * Adds a listener function (`fn`) to a particular event type of the object. You can optionally specify the context of the listener (object the this keyword will point to). You can also pass several space-separated types (e.g. `'click dblclick'`).\r\n \t *\r\n \t * @alternative\r\n \t * @method on(eventMap: Object): this\r\n \t * Adds a set of type/listener pairs, e.g. `{click: onClick, mousemove: onMouseMove}`\r\n \t */\r\n \ton: function (types, fn, context) {\r\n\r\n \t\t// types can be a map of types/handlers\r\n \t\tif (typeof types === 'object') {\r\n \t\t\tfor (var type in types) {\r\n \t\t\t\t// we don't process space-separated events here for performance;\r\n \t\t\t\t// it's a hot path since Layer uses the on(obj) syntax\r\n \t\t\t\tthis._on(type, types[type], fn);\r\n \t\t\t}\r\n\r\n \t\t} else {\r\n \t\t\t// types can be a string of space-separated words\r\n \t\t\ttypes = splitWords(types);\r\n\r\n \t\t\tfor (var i = 0, len = types.length; i < len; i++) {\r\n \t\t\t\tthis._on(types[i], fn, context);\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t/* @method off(type: String, fn?: Function, context?: Object): this\r\n \t * Removes a previously added listener function. If no function is specified, it will remove all the listeners of that particular event from the object. Note that if you passed a custom context to `on`, you must pass the same context to `off` in order to remove the listener.\r\n \t *\r\n \t * @alternative\r\n \t * @method off(eventMap: Object): this\r\n \t * Removes a set of type/listener pairs.\r\n \t *\r\n \t * @alternative\r\n \t * @method off: this\r\n \t * Removes all listeners to all events on the object. This includes implicitly attached events.\r\n \t */\r\n \toff: function (types, fn, context) {\r\n\r\n \t\tif (!types) {\r\n \t\t\t// clear all listeners if called without arguments\r\n \t\t\tdelete this._events;\r\n\r\n \t\t} else if (typeof types === 'object') {\r\n \t\t\tfor (var type in types) {\r\n \t\t\t\tthis._off(type, types[type], fn);\r\n \t\t\t}\r\n\r\n \t\t} else {\r\n \t\t\ttypes = splitWords(types);\r\n\r\n \t\t\tfor (var i = 0, len = types.length; i < len; i++) {\r\n \t\t\t\tthis._off(types[i], fn, context);\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// attach listener (without syntactic sugar now)\r\n \t_on: function (type, fn, context) {\r\n \t\tthis._events = this._events || {};\r\n\r\n \t\t/* get/init listeners for type */\r\n \t\tvar typeListeners = this._events[type];\r\n \t\tif (!typeListeners) {\r\n \t\t\ttypeListeners = [];\r\n \t\t\tthis._events[type] = typeListeners;\r\n \t\t}\r\n\r\n \t\tif (context === this) {\r\n \t\t\t// Less memory footprint.\r\n \t\t\tcontext = undefined;\r\n \t\t}\r\n \t\tvar newListener = {fn: fn, ctx: context},\r\n \t\t listeners = typeListeners;\r\n\r\n \t\t// check if fn already there\r\n \t\tfor (var i = 0, len = listeners.length; i < len; i++) {\r\n \t\t\tif (listeners[i].fn === fn && listeners[i].ctx === context) {\r\n \t\t\t\treturn;\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\tlisteners.push(newListener);\r\n \t},\r\n\r\n \t_off: function (type, fn, context) {\r\n \t\tvar listeners,\r\n \t\t i,\r\n \t\t len;\r\n\r\n \t\tif (!this._events) { return; }\r\n\r\n \t\tlisteners = this._events[type];\r\n\r\n \t\tif (!listeners) {\r\n \t\t\treturn;\r\n \t\t}\r\n\r\n \t\tif (!fn) {\r\n \t\t\t// Set all removed listeners to noop so they are not called if remove happens in fire\r\n \t\t\tfor (i = 0, len = listeners.length; i < len; i++) {\r\n \t\t\t\tlisteners[i].fn = falseFn;\r\n \t\t\t}\r\n \t\t\t// clear all listeners for a type if function isn't specified\r\n \t\t\tdelete this._events[type];\r\n \t\t\treturn;\r\n \t\t}\r\n\r\n \t\tif (context === this) {\r\n \t\t\tcontext = undefined;\r\n \t\t}\r\n\r\n \t\tif (listeners) {\r\n\r\n \t\t\t// find fn and remove it\r\n \t\t\tfor (i = 0, len = listeners.length; i < len; i++) {\r\n \t\t\t\tvar l = listeners[i];\r\n \t\t\t\tif (l.ctx !== context) { continue; }\r\n \t\t\t\tif (l.fn === fn) {\r\n\r\n \t\t\t\t\t// set the removed listener to noop so that's not called if remove happens in fire\r\n \t\t\t\t\tl.fn = falseFn;\r\n\r\n \t\t\t\t\tif (this._firingCount) {\r\n \t\t\t\t\t\t/* copy array in case events are being fired */\r\n \t\t\t\t\t\tthis._events[type] = listeners = listeners.slice();\r\n \t\t\t\t\t}\r\n \t\t\t\t\tlisteners.splice(i, 1);\r\n\r\n \t\t\t\t\treturn;\r\n \t\t\t\t}\r\n \t\t\t}\r\n \t\t}\r\n \t},\r\n\r\n \t// @method fire(type: String, data?: Object, propagate?: Boolean): this\r\n \t// Fires an event of the specified type. You can optionally provide an data\r\n \t// object — the first argument of the listener function will contain its\r\n \t// properties. The event can optionally be propagated to event parents.\r\n \tfire: function (type, data, propagate) {\r\n \t\tif (!this.listens(type, propagate)) { return this; }\r\n\r\n \t\tvar event = extend({}, data, {\r\n \t\t\ttype: type,\r\n \t\t\ttarget: this,\r\n \t\t\tsourceTarget: data && data.sourceTarget || this\r\n \t\t});\r\n\r\n \t\tif (this._events) {\r\n \t\t\tvar listeners = this._events[type];\r\n\r\n \t\t\tif (listeners) {\r\n \t\t\t\tthis._firingCount = (this._firingCount + 1) || 1;\r\n \t\t\t\tfor (var i = 0, len = listeners.length; i < len; i++) {\r\n \t\t\t\t\tvar l = listeners[i];\r\n \t\t\t\t\tl.fn.call(l.ctx || this, event);\r\n \t\t\t\t}\r\n\r\n \t\t\t\tthis._firingCount--;\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\tif (propagate) {\r\n \t\t\t// propagate the event to parents (set with addEventParent)\r\n \t\t\tthis._propagateEvent(event);\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method listens(type: String): Boolean\r\n \t// Returns `true` if a particular event type has any listeners attached to it.\r\n \tlistens: function (type, propagate) {\r\n \t\tvar listeners = this._events && this._events[type];\r\n \t\tif (listeners && listeners.length) { return true; }\r\n\r\n \t\tif (propagate) {\r\n \t\t\t// also check parents for listeners if event propagates\r\n \t\t\tfor (var id in this._eventParents) {\r\n \t\t\t\tif (this._eventParents[id].listens(type, propagate)) { return true; }\r\n \t\t\t}\r\n \t\t}\r\n \t\treturn false;\r\n \t},\r\n\r\n \t// @method once(…): this\r\n \t// Behaves as [`on(…)`](#evented-on), except the listener will only get fired once and then removed.\r\n \tonce: function (types, fn, context) {\r\n\r\n \t\tif (typeof types === 'object') {\r\n \t\t\tfor (var type in types) {\r\n \t\t\t\tthis.once(type, types[type], fn);\r\n \t\t\t}\r\n \t\t\treturn this;\r\n \t\t}\r\n\r\n \t\tvar handler = bind(function () {\r\n \t\t\tthis\r\n \t\t\t .off(types, fn, context)\r\n \t\t\t .off(types, handler, context);\r\n \t\t}, this);\r\n\r\n \t\t// add a listener that's executed once and removed after that\r\n \t\treturn this\r\n \t\t .on(types, fn, context)\r\n \t\t .on(types, handler, context);\r\n \t},\r\n\r\n \t// @method addEventParent(obj: Evented): this\r\n \t// Adds an event parent - an `Evented` that will receive propagated events\r\n \taddEventParent: function (obj) {\r\n \t\tthis._eventParents = this._eventParents || {};\r\n \t\tthis._eventParents[stamp(obj)] = obj;\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method removeEventParent(obj: Evented): this\r\n \t// Removes an event parent, so it will stop receiving propagated events\r\n \tremoveEventParent: function (obj) {\r\n \t\tif (this._eventParents) {\r\n \t\t\tdelete this._eventParents[stamp(obj)];\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \t_propagateEvent: function (e) {\r\n \t\tfor (var id in this._eventParents) {\r\n \t\t\tthis._eventParents[id].fire(e.type, extend({\r\n \t\t\t\tlayer: e.target,\r\n \t\t\t\tpropagatedFrom: e.target\r\n \t\t\t}, e), true);\r\n \t\t}\r\n \t}\r\n };\r\n\r\n // aliases; we should ditch those eventually\r\n\r\n // @method addEventListener(…): this\r\n // Alias to [`on(…)`](#evented-on)\r\n Events.addEventListener = Events.on;\r\n\r\n // @method removeEventListener(…): this\r\n // Alias to [`off(…)`](#evented-off)\r\n\r\n // @method clearAllEventListeners(…): this\r\n // Alias to [`off()`](#evented-off)\r\n Events.removeEventListener = Events.clearAllEventListeners = Events.off;\r\n\r\n // @method addOneTimeEventListener(…): this\r\n // Alias to [`once(…)`](#evented-once)\r\n Events.addOneTimeEventListener = Events.once;\r\n\r\n // @method fireEvent(…): this\r\n // Alias to [`fire(…)`](#evented-fire)\r\n Events.fireEvent = Events.fire;\r\n\r\n // @method hasEventListeners(…): Boolean\r\n // Alias to [`listens(…)`](#evented-listens)\r\n Events.hasEventListeners = Events.listens;\r\n\r\n var Evented = Class.extend(Events);\n\n /*\r\n * @class Point\r\n * @aka L.Point\r\n *\r\n * Represents a point with `x` and `y` coordinates in pixels.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * var point = L.point(200, 300);\r\n * ```\r\n *\r\n * All Leaflet methods and options that accept `Point` objects also accept them in a simple Array form (unless noted otherwise), so these lines are equivalent:\r\n *\r\n * ```js\r\n * map.panBy([200, 300]);\r\n * map.panBy(L.point(200, 300));\r\n * ```\r\n *\r\n * Note that `Point` does not inherit from Leaflet's `Class` object,\r\n * which means new classes can't inherit from it, and new methods\r\n * can't be added to it with the `include` function.\r\n */\r\n\r\n function Point(x, y, round) {\r\n \t// @property x: Number; The `x` coordinate of the point\r\n \tthis.x = (round ? Math.round(x) : x);\r\n \t// @property y: Number; The `y` coordinate of the point\r\n \tthis.y = (round ? Math.round(y) : y);\r\n }\r\n\r\n var trunc = Math.trunc || function (v) {\r\n \treturn v > 0 ? Math.floor(v) : Math.ceil(v);\r\n };\r\n\r\n Point.prototype = {\r\n\r\n \t// @method clone(): Point\r\n \t// Returns a copy of the current point.\r\n \tclone: function () {\r\n \t\treturn new Point(this.x, this.y);\r\n \t},\r\n\r\n \t// @method add(otherPoint: Point): Point\r\n \t// Returns the result of addition of the current and the given points.\r\n \tadd: function (point) {\r\n \t\t// non-destructive, returns a new point\r\n \t\treturn this.clone()._add(toPoint(point));\r\n \t},\r\n\r\n \t_add: function (point) {\r\n \t\t// destructive, used directly for performance in situations where it's safe to modify existing point\r\n \t\tthis.x += point.x;\r\n \t\tthis.y += point.y;\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method subtract(otherPoint: Point): Point\r\n \t// Returns the result of subtraction of the given point from the current.\r\n \tsubtract: function (point) {\r\n \t\treturn this.clone()._subtract(toPoint(point));\r\n \t},\r\n\r\n \t_subtract: function (point) {\r\n \t\tthis.x -= point.x;\r\n \t\tthis.y -= point.y;\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method divideBy(num: Number): Point\r\n \t// Returns the result of division of the current point by the given number.\r\n \tdivideBy: function (num) {\r\n \t\treturn this.clone()._divideBy(num);\r\n \t},\r\n\r\n \t_divideBy: function (num) {\r\n \t\tthis.x /= num;\r\n \t\tthis.y /= num;\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method multiplyBy(num: Number): Point\r\n \t// Returns the result of multiplication of the current point by the given number.\r\n \tmultiplyBy: function (num) {\r\n \t\treturn this.clone()._multiplyBy(num);\r\n \t},\r\n\r\n \t_multiplyBy: function (num) {\r\n \t\tthis.x *= num;\r\n \t\tthis.y *= num;\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method scaleBy(scale: Point): Point\r\n \t// Multiply each coordinate of the current point by each coordinate of\r\n \t// `scale`. In linear algebra terms, multiply the point by the\r\n \t// [scaling matrix](https://en.wikipedia.org/wiki/Scaling_%28geometry%29#Matrix_representation)\r\n \t// defined by `scale`.\r\n \tscaleBy: function (point) {\r\n \t\treturn new Point(this.x * point.x, this.y * point.y);\r\n \t},\r\n\r\n \t// @method unscaleBy(scale: Point): Point\r\n \t// Inverse of `scaleBy`. Divide each coordinate of the current point by\r\n \t// each coordinate of `scale`.\r\n \tunscaleBy: function (point) {\r\n \t\treturn new Point(this.x / point.x, this.y / point.y);\r\n \t},\r\n\r\n \t// @method round(): Point\r\n \t// Returns a copy of the current point with rounded coordinates.\r\n \tround: function () {\r\n \t\treturn this.clone()._round();\r\n \t},\r\n\r\n \t_round: function () {\r\n \t\tthis.x = Math.round(this.x);\r\n \t\tthis.y = Math.round(this.y);\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method floor(): Point\r\n \t// Returns a copy of the current point with floored coordinates (rounded down).\r\n \tfloor: function () {\r\n \t\treturn this.clone()._floor();\r\n \t},\r\n\r\n \t_floor: function () {\r\n \t\tthis.x = Math.floor(this.x);\r\n \t\tthis.y = Math.floor(this.y);\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method ceil(): Point\r\n \t// Returns a copy of the current point with ceiled coordinates (rounded up).\r\n \tceil: function () {\r\n \t\treturn this.clone()._ceil();\r\n \t},\r\n\r\n \t_ceil: function () {\r\n \t\tthis.x = Math.ceil(this.x);\r\n \t\tthis.y = Math.ceil(this.y);\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method trunc(): Point\r\n \t// Returns a copy of the current point with truncated coordinates (rounded towards zero).\r\n \ttrunc: function () {\r\n \t\treturn this.clone()._trunc();\r\n \t},\r\n\r\n \t_trunc: function () {\r\n \t\tthis.x = trunc(this.x);\r\n \t\tthis.y = trunc(this.y);\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method distanceTo(otherPoint: Point): Number\r\n \t// Returns the cartesian distance between the current and the given points.\r\n \tdistanceTo: function (point) {\r\n \t\tpoint = toPoint(point);\r\n\r\n \t\tvar x = point.x - this.x,\r\n \t\t y = point.y - this.y;\r\n\r\n \t\treturn Math.sqrt(x * x + y * y);\r\n \t},\r\n\r\n \t// @method equals(otherPoint: Point): Boolean\r\n \t// Returns `true` if the given point has the same coordinates.\r\n \tequals: function (point) {\r\n \t\tpoint = toPoint(point);\r\n\r\n \t\treturn point.x === this.x &&\r\n \t\t point.y === this.y;\r\n \t},\r\n\r\n \t// @method contains(otherPoint: Point): Boolean\r\n \t// Returns `true` if both coordinates of the given point are less than the corresponding current point coordinates (in absolute values).\r\n \tcontains: function (point) {\r\n \t\tpoint = toPoint(point);\r\n\r\n \t\treturn Math.abs(point.x) <= Math.abs(this.x) &&\r\n \t\t Math.abs(point.y) <= Math.abs(this.y);\r\n \t},\r\n\r\n \t// @method toString(): String\r\n \t// Returns a string representation of the point for debugging purposes.\r\n \ttoString: function () {\r\n \t\treturn 'Point(' +\r\n \t\t formatNum(this.x) + ', ' +\r\n \t\t formatNum(this.y) + ')';\r\n \t}\r\n };\r\n\r\n // @factory L.point(x: Number, y: Number, round?: Boolean)\r\n // Creates a Point object with the given `x` and `y` coordinates. If optional `round` is set to true, rounds the `x` and `y` values.\r\n\r\n // @alternative\r\n // @factory L.point(coords: Number[])\r\n // Expects an array of the form `[x, y]` instead.\r\n\r\n // @alternative\r\n // @factory L.point(coords: Object)\r\n // Expects a plain object of the form `{x: Number, y: Number}` instead.\r\n function toPoint(x, y, round) {\r\n \tif (x instanceof Point) {\r\n \t\treturn x;\r\n \t}\r\n \tif (isArray(x)) {\r\n \t\treturn new Point(x[0], x[1]);\r\n \t}\r\n \tif (x === undefined || x === null) {\r\n \t\treturn x;\r\n \t}\r\n \tif (typeof x === 'object' && 'x' in x && 'y' in x) {\r\n \t\treturn new Point(x.x, x.y);\r\n \t}\r\n \treturn new Point(x, y, round);\r\n }\n\n /*\r\n * @class Bounds\r\n * @aka L.Bounds\r\n *\r\n * Represents a rectangular area in pixel coordinates.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * var p1 = L.point(10, 10),\r\n * p2 = L.point(40, 60),\r\n * bounds = L.bounds(p1, p2);\r\n * ```\r\n *\r\n * All Leaflet methods that accept `Bounds` objects also accept them in a simple Array form (unless noted otherwise), so the bounds example above can be passed like this:\r\n *\r\n * ```js\r\n * otherBounds.intersects([[10, 10], [40, 60]]);\r\n * ```\r\n *\r\n * Note that `Bounds` does not inherit from Leaflet's `Class` object,\r\n * which means new classes can't inherit from it, and new methods\r\n * can't be added to it with the `include` function.\r\n */\r\n\r\n function Bounds(a, b) {\r\n \tif (!a) { return; }\r\n\r\n \tvar points = b ? [a, b] : a;\r\n\r\n \tfor (var i = 0, len = points.length; i < len; i++) {\r\n \t\tthis.extend(points[i]);\r\n \t}\r\n }\r\n\r\n Bounds.prototype = {\r\n \t// @method extend(point: Point): this\r\n \t// Extends the bounds to contain the given point.\r\n \textend: function (point) { // (Point)\r\n \t\tpoint = toPoint(point);\r\n\r\n \t\t// @property min: Point\r\n \t\t// The top left corner of the rectangle.\r\n \t\t// @property max: Point\r\n \t\t// The bottom right corner of the rectangle.\r\n \t\tif (!this.min && !this.max) {\r\n \t\t\tthis.min = point.clone();\r\n \t\t\tthis.max = point.clone();\r\n \t\t} else {\r\n \t\t\tthis.min.x = Math.min(point.x, this.min.x);\r\n \t\t\tthis.max.x = Math.max(point.x, this.max.x);\r\n \t\t\tthis.min.y = Math.min(point.y, this.min.y);\r\n \t\t\tthis.max.y = Math.max(point.y, this.max.y);\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method getCenter(round?: Boolean): Point\r\n \t// Returns the center point of the bounds.\r\n \tgetCenter: function (round) {\r\n \t\treturn new Point(\r\n \t\t (this.min.x + this.max.x) / 2,\r\n \t\t (this.min.y + this.max.y) / 2, round);\r\n \t},\r\n\r\n \t// @method getBottomLeft(): Point\r\n \t// Returns the bottom-left point of the bounds.\r\n \tgetBottomLeft: function () {\r\n \t\treturn new Point(this.min.x, this.max.y);\r\n \t},\r\n\r\n \t// @method getTopRight(): Point\r\n \t// Returns the top-right point of the bounds.\r\n \tgetTopRight: function () { // -> Point\r\n \t\treturn new Point(this.max.x, this.min.y);\r\n \t},\r\n\r\n \t// @method getTopLeft(): Point\r\n \t// Returns the top-left point of the bounds (i.e. [`this.min`](#bounds-min)).\r\n \tgetTopLeft: function () {\r\n \t\treturn this.min; // left, top\r\n \t},\r\n\r\n \t// @method getBottomRight(): Point\r\n \t// Returns the bottom-right point of the bounds (i.e. [`this.max`](#bounds-max)).\r\n \tgetBottomRight: function () {\r\n \t\treturn this.max; // right, bottom\r\n \t},\r\n\r\n \t// @method getSize(): Point\r\n \t// Returns the size of the given bounds\r\n \tgetSize: function () {\r\n \t\treturn this.max.subtract(this.min);\r\n \t},\r\n\r\n \t// @method contains(otherBounds: Bounds): Boolean\r\n \t// Returns `true` if the rectangle contains the given one.\r\n \t// @alternative\r\n \t// @method contains(point: Point): Boolean\r\n \t// Returns `true` if the rectangle contains the given point.\r\n \tcontains: function (obj) {\r\n \t\tvar min, max;\r\n\r\n \t\tif (typeof obj[0] === 'number' || obj instanceof Point) {\r\n \t\t\tobj = toPoint(obj);\r\n \t\t} else {\r\n \t\t\tobj = toBounds(obj);\r\n \t\t}\r\n\r\n \t\tif (obj instanceof Bounds) {\r\n \t\t\tmin = obj.min;\r\n \t\t\tmax = obj.max;\r\n \t\t} else {\r\n \t\t\tmin = max = obj;\r\n \t\t}\r\n\r\n \t\treturn (min.x >= this.min.x) &&\r\n \t\t (max.x <= this.max.x) &&\r\n \t\t (min.y >= this.min.y) &&\r\n \t\t (max.y <= this.max.y);\r\n \t},\r\n\r\n \t// @method intersects(otherBounds: Bounds): Boolean\r\n \t// Returns `true` if the rectangle intersects the given bounds. Two bounds\r\n \t// intersect if they have at least one point in common.\r\n \tintersects: function (bounds) { // (Bounds) -> Boolean\r\n \t\tbounds = toBounds(bounds);\r\n\r\n \t\tvar min = this.min,\r\n \t\t max = this.max,\r\n \t\t min2 = bounds.min,\r\n \t\t max2 = bounds.max,\r\n \t\t xIntersects = (max2.x >= min.x) && (min2.x <= max.x),\r\n \t\t yIntersects = (max2.y >= min.y) && (min2.y <= max.y);\r\n\r\n \t\treturn xIntersects && yIntersects;\r\n \t},\r\n\r\n \t// @method overlaps(otherBounds: Bounds): Boolean\r\n \t// Returns `true` if the rectangle overlaps the given bounds. Two bounds\r\n \t// overlap if their intersection is an area.\r\n \toverlaps: function (bounds) { // (Bounds) -> Boolean\r\n \t\tbounds = toBounds(bounds);\r\n\r\n \t\tvar min = this.min,\r\n \t\t max = this.max,\r\n \t\t min2 = bounds.min,\r\n \t\t max2 = bounds.max,\r\n \t\t xOverlaps = (max2.x > min.x) && (min2.x < max.x),\r\n \t\t yOverlaps = (max2.y > min.y) && (min2.y < max.y);\r\n\r\n \t\treturn xOverlaps && yOverlaps;\r\n \t},\r\n\r\n \tisValid: function () {\r\n \t\treturn !!(this.min && this.max);\r\n \t}\r\n };\r\n\r\n\r\n // @factory L.bounds(corner1: Point, corner2: Point)\r\n // Creates a Bounds object from two corners coordinate pairs.\r\n // @alternative\r\n // @factory L.bounds(points: Point[])\r\n // Creates a Bounds object from the given array of points.\r\n function toBounds(a, b) {\r\n \tif (!a || a instanceof Bounds) {\r\n \t\treturn a;\r\n \t}\r\n \treturn new Bounds(a, b);\r\n }\n\n /*\r\n * @class LatLngBounds\r\n * @aka L.LatLngBounds\r\n *\r\n * Represents a rectangular geographical area on a map.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * var corner1 = L.latLng(40.712, -74.227),\r\n * corner2 = L.latLng(40.774, -74.125),\r\n * bounds = L.latLngBounds(corner1, corner2);\r\n * ```\r\n *\r\n * All Leaflet methods that accept LatLngBounds objects also accept them in a simple Array form (unless noted otherwise), so the bounds example above can be passed like this:\r\n *\r\n * ```js\r\n * map.fitBounds([\r\n * \t[40.712, -74.227],\r\n * \t[40.774, -74.125]\r\n * ]);\r\n * ```\r\n *\r\n * Caution: if the area crosses the antimeridian (often confused with the International Date Line), you must specify corners _outside_ the [-180, 180] degrees longitude range.\r\n *\r\n * Note that `LatLngBounds` does not inherit from Leaflet's `Class` object,\r\n * which means new classes can't inherit from it, and new methods\r\n * can't be added to it with the `include` function.\r\n */\r\n\r\n function LatLngBounds(corner1, corner2) { // (LatLng, LatLng) or (LatLng[])\r\n \tif (!corner1) { return; }\r\n\r\n \tvar latlngs = corner2 ? [corner1, corner2] : corner1;\r\n\r\n \tfor (var i = 0, len = latlngs.length; i < len; i++) {\r\n \t\tthis.extend(latlngs[i]);\r\n \t}\r\n }\r\n\r\n LatLngBounds.prototype = {\r\n\r\n \t// @method extend(latlng: LatLng): this\r\n \t// Extend the bounds to contain the given point\r\n\r\n \t// @alternative\r\n \t// @method extend(otherBounds: LatLngBounds): this\r\n \t// Extend the bounds to contain the given bounds\r\n \textend: function (obj) {\r\n \t\tvar sw = this._southWest,\r\n \t\t ne = this._northEast,\r\n \t\t sw2, ne2;\r\n\r\n \t\tif (obj instanceof LatLng) {\r\n \t\t\tsw2 = obj;\r\n \t\t\tne2 = obj;\r\n\r\n \t\t} else if (obj instanceof LatLngBounds) {\r\n \t\t\tsw2 = obj._southWest;\r\n \t\t\tne2 = obj._northEast;\r\n\r\n \t\t\tif (!sw2 || !ne2) { return this; }\r\n\r\n \t\t} else {\r\n \t\t\treturn obj ? this.extend(toLatLng(obj) || toLatLngBounds(obj)) : this;\r\n \t\t}\r\n\r\n \t\tif (!sw && !ne) {\r\n \t\t\tthis._southWest = new LatLng(sw2.lat, sw2.lng);\r\n \t\t\tthis._northEast = new LatLng(ne2.lat, ne2.lng);\r\n \t\t} else {\r\n \t\t\tsw.lat = Math.min(sw2.lat, sw.lat);\r\n \t\t\tsw.lng = Math.min(sw2.lng, sw.lng);\r\n \t\t\tne.lat = Math.max(ne2.lat, ne.lat);\r\n \t\t\tne.lng = Math.max(ne2.lng, ne.lng);\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method pad(bufferRatio: Number): LatLngBounds\r\n \t// Returns bounds created by extending or retracting the current bounds by a given ratio in each direction.\r\n \t// For example, a ratio of 0.5 extends the bounds by 50% in each direction.\r\n \t// Negative values will retract the bounds.\r\n \tpad: function (bufferRatio) {\r\n \t\tvar sw = this._southWest,\r\n \t\t ne = this._northEast,\r\n \t\t heightBuffer = Math.abs(sw.lat - ne.lat) * bufferRatio,\r\n \t\t widthBuffer = Math.abs(sw.lng - ne.lng) * bufferRatio;\r\n\r\n \t\treturn new LatLngBounds(\r\n \t\t new LatLng(sw.lat - heightBuffer, sw.lng - widthBuffer),\r\n \t\t new LatLng(ne.lat + heightBuffer, ne.lng + widthBuffer));\r\n \t},\r\n\r\n \t// @method getCenter(): LatLng\r\n \t// Returns the center point of the bounds.\r\n \tgetCenter: function () {\r\n \t\treturn new LatLng(\r\n \t\t (this._southWest.lat + this._northEast.lat) / 2,\r\n \t\t (this._southWest.lng + this._northEast.lng) / 2);\r\n \t},\r\n\r\n \t// @method getSouthWest(): LatLng\r\n \t// Returns the south-west point of the bounds.\r\n \tgetSouthWest: function () {\r\n \t\treturn this._southWest;\r\n \t},\r\n\r\n \t// @method getNorthEast(): LatLng\r\n \t// Returns the north-east point of the bounds.\r\n \tgetNorthEast: function () {\r\n \t\treturn this._northEast;\r\n \t},\r\n\r\n \t// @method getNorthWest(): LatLng\r\n \t// Returns the north-west point of the bounds.\r\n \tgetNorthWest: function () {\r\n \t\treturn new LatLng(this.getNorth(), this.getWest());\r\n \t},\r\n\r\n \t// @method getSouthEast(): LatLng\r\n \t// Returns the south-east point of the bounds.\r\n \tgetSouthEast: function () {\r\n \t\treturn new LatLng(this.getSouth(), this.getEast());\r\n \t},\r\n\r\n \t// @method getWest(): Number\r\n \t// Returns the west longitude of the bounds\r\n \tgetWest: function () {\r\n \t\treturn this._southWest.lng;\r\n \t},\r\n\r\n \t// @method getSouth(): Number\r\n \t// Returns the south latitude of the bounds\r\n \tgetSouth: function () {\r\n \t\treturn this._southWest.lat;\r\n \t},\r\n\r\n \t// @method getEast(): Number\r\n \t// Returns the east longitude of the bounds\r\n \tgetEast: function () {\r\n \t\treturn this._northEast.lng;\r\n \t},\r\n\r\n \t// @method getNorth(): Number\r\n \t// Returns the north latitude of the bounds\r\n \tgetNorth: function () {\r\n \t\treturn this._northEast.lat;\r\n \t},\r\n\r\n \t// @method contains(otherBounds: LatLngBounds): Boolean\r\n \t// Returns `true` if the rectangle contains the given one.\r\n\r\n \t// @alternative\r\n \t// @method contains (latlng: LatLng): Boolean\r\n \t// Returns `true` if the rectangle contains the given point.\r\n \tcontains: function (obj) { // (LatLngBounds) or (LatLng) -> Boolean\r\n \t\tif (typeof obj[0] === 'number' || obj instanceof LatLng || 'lat' in obj) {\r\n \t\t\tobj = toLatLng(obj);\r\n \t\t} else {\r\n \t\t\tobj = toLatLngBounds(obj);\r\n \t\t}\r\n\r\n \t\tvar sw = this._southWest,\r\n \t\t ne = this._northEast,\r\n \t\t sw2, ne2;\r\n\r\n \t\tif (obj instanceof LatLngBounds) {\r\n \t\t\tsw2 = obj.getSouthWest();\r\n \t\t\tne2 = obj.getNorthEast();\r\n \t\t} else {\r\n \t\t\tsw2 = ne2 = obj;\r\n \t\t}\r\n\r\n \t\treturn (sw2.lat >= sw.lat) && (ne2.lat <= ne.lat) &&\r\n \t\t (sw2.lng >= sw.lng) && (ne2.lng <= ne.lng);\r\n \t},\r\n\r\n \t// @method intersects(otherBounds: LatLngBounds): Boolean\r\n \t// Returns `true` if the rectangle intersects the given bounds. Two bounds intersect if they have at least one point in common.\r\n \tintersects: function (bounds) {\r\n \t\tbounds = toLatLngBounds(bounds);\r\n\r\n \t\tvar sw = this._southWest,\r\n \t\t ne = this._northEast,\r\n \t\t sw2 = bounds.getSouthWest(),\r\n \t\t ne2 = bounds.getNorthEast(),\r\n\r\n \t\t latIntersects = (ne2.lat >= sw.lat) && (sw2.lat <= ne.lat),\r\n \t\t lngIntersects = (ne2.lng >= sw.lng) && (sw2.lng <= ne.lng);\r\n\r\n \t\treturn latIntersects && lngIntersects;\r\n \t},\r\n\r\n \t// @method overlaps(otherBounds: LatLngBounds): Boolean\r\n \t// Returns `true` if the rectangle overlaps the given bounds. Two bounds overlap if their intersection is an area.\r\n \toverlaps: function (bounds) {\r\n \t\tbounds = toLatLngBounds(bounds);\r\n\r\n \t\tvar sw = this._southWest,\r\n \t\t ne = this._northEast,\r\n \t\t sw2 = bounds.getSouthWest(),\r\n \t\t ne2 = bounds.getNorthEast(),\r\n\r\n \t\t latOverlaps = (ne2.lat > sw.lat) && (sw2.lat < ne.lat),\r\n \t\t lngOverlaps = (ne2.lng > sw.lng) && (sw2.lng < ne.lng);\r\n\r\n \t\treturn latOverlaps && lngOverlaps;\r\n \t},\r\n\r\n \t// @method toBBoxString(): String\r\n \t// Returns a string with bounding box coordinates in a 'southwest_lng,southwest_lat,northeast_lng,northeast_lat' format. Useful for sending requests to web services that return geo data.\r\n \ttoBBoxString: function () {\r\n \t\treturn [this.getWest(), this.getSouth(), this.getEast(), this.getNorth()].join(',');\r\n \t},\r\n\r\n \t// @method equals(otherBounds: LatLngBounds, maxMargin?: Number): Boolean\r\n \t// Returns `true` if the rectangle is equivalent (within a small margin of error) to the given bounds. The margin of error can be overridden by setting `maxMargin` to a small number.\r\n \tequals: function (bounds, maxMargin) {\r\n \t\tif (!bounds) { return false; }\r\n\r\n \t\tbounds = toLatLngBounds(bounds);\r\n\r\n \t\treturn this._southWest.equals(bounds.getSouthWest(), maxMargin) &&\r\n \t\t this._northEast.equals(bounds.getNorthEast(), maxMargin);\r\n \t},\r\n\r\n \t// @method isValid(): Boolean\r\n \t// Returns `true` if the bounds are properly initialized.\r\n \tisValid: function () {\r\n \t\treturn !!(this._southWest && this._northEast);\r\n \t}\r\n };\r\n\r\n // TODO International date line?\r\n\r\n // @factory L.latLngBounds(corner1: LatLng, corner2: LatLng)\r\n // Creates a `LatLngBounds` object by defining two diagonally opposite corners of the rectangle.\r\n\r\n // @alternative\r\n // @factory L.latLngBounds(latlngs: LatLng[])\r\n // Creates a `LatLngBounds` object defined by the geographical points it contains. Very useful for zooming the map to fit a particular set of locations with [`fitBounds`](#map-fitbounds).\r\n function toLatLngBounds(a, b) {\r\n \tif (a instanceof LatLngBounds) {\r\n \t\treturn a;\r\n \t}\r\n \treturn new LatLngBounds(a, b);\r\n }\n\n /* @class LatLng\r\n * @aka L.LatLng\r\n *\r\n * Represents a geographical point with a certain latitude and longitude.\r\n *\r\n * @example\r\n *\r\n * ```\r\n * var latlng = L.latLng(50.5, 30.5);\r\n * ```\r\n *\r\n * All Leaflet methods that accept LatLng objects also accept them in a simple Array form and simple object form (unless noted otherwise), so these lines are equivalent:\r\n *\r\n * ```\r\n * map.panTo([50, 30]);\r\n * map.panTo({lon: 30, lat: 50});\r\n * map.panTo({lat: 50, lng: 30});\r\n * map.panTo(L.latLng(50, 30));\r\n * ```\r\n *\r\n * Note that `LatLng` does not inherit from Leaflet's `Class` object,\r\n * which means new classes can't inherit from it, and new methods\r\n * can't be added to it with the `include` function.\r\n */\r\n\r\n function LatLng(lat, lng, alt) {\r\n \tif (isNaN(lat) || isNaN(lng)) {\r\n \t\tthrow new Error('Invalid LatLng object: (' + lat + ', ' + lng + ')');\r\n \t}\r\n\r\n \t// @property lat: Number\r\n \t// Latitude in degrees\r\n \tthis.lat = +lat;\r\n\r\n \t// @property lng: Number\r\n \t// Longitude in degrees\r\n \tthis.lng = +lng;\r\n\r\n \t// @property alt: Number\r\n \t// Altitude in meters (optional)\r\n \tif (alt !== undefined) {\r\n \t\tthis.alt = +alt;\r\n \t}\r\n }\r\n\r\n LatLng.prototype = {\r\n \t// @method equals(otherLatLng: LatLng, maxMargin?: Number): Boolean\r\n \t// Returns `true` if the given `LatLng` point is at the same position (within a small margin of error). The margin of error can be overridden by setting `maxMargin` to a small number.\r\n \tequals: function (obj, maxMargin) {\r\n \t\tif (!obj) { return false; }\r\n\r\n \t\tobj = toLatLng(obj);\r\n\r\n \t\tvar margin = Math.max(\r\n \t\t Math.abs(this.lat - obj.lat),\r\n \t\t Math.abs(this.lng - obj.lng));\r\n\r\n \t\treturn margin <= (maxMargin === undefined ? 1.0E-9 : maxMargin);\r\n \t},\r\n\r\n \t// @method toString(): String\r\n \t// Returns a string representation of the point (for debugging purposes).\r\n \ttoString: function (precision) {\r\n \t\treturn 'LatLng(' +\r\n \t\t formatNum(this.lat, precision) + ', ' +\r\n \t\t formatNum(this.lng, precision) + ')';\r\n \t},\r\n\r\n \t// @method distanceTo(otherLatLng: LatLng): Number\r\n \t// Returns the distance (in meters) to the given `LatLng` calculated using the [Spherical Law of Cosines](https://en.wikipedia.org/wiki/Spherical_law_of_cosines).\r\n \tdistanceTo: function (other) {\r\n \t\treturn Earth.distance(this, toLatLng(other));\r\n \t},\r\n\r\n \t// @method wrap(): LatLng\r\n \t// Returns a new `LatLng` object with the longitude wrapped so it's always between -180 and +180 degrees.\r\n \twrap: function () {\r\n \t\treturn Earth.wrapLatLng(this);\r\n \t},\r\n\r\n \t// @method toBounds(sizeInMeters: Number): LatLngBounds\r\n \t// Returns a new `LatLngBounds` object in which each boundary is `sizeInMeters/2` meters apart from the `LatLng`.\r\n \ttoBounds: function (sizeInMeters) {\r\n \t\tvar latAccuracy = 180 * sizeInMeters / 40075017,\r\n \t\t lngAccuracy = latAccuracy / Math.cos((Math.PI / 180) * this.lat);\r\n\r\n \t\treturn toLatLngBounds(\r\n \t\t [this.lat - latAccuracy, this.lng - lngAccuracy],\r\n \t\t [this.lat + latAccuracy, this.lng + lngAccuracy]);\r\n \t},\r\n\r\n \tclone: function () {\r\n \t\treturn new LatLng(this.lat, this.lng, this.alt);\r\n \t}\r\n };\r\n\r\n\r\n\r\n // @factory L.latLng(latitude: Number, longitude: Number, altitude?: Number): LatLng\r\n // Creates an object representing a geographical point with the given latitude and longitude (and optionally altitude).\r\n\r\n // @alternative\r\n // @factory L.latLng(coords: Array): LatLng\r\n // Expects an array of the form `[Number, Number]` or `[Number, Number, Number]` instead.\r\n\r\n // @alternative\r\n // @factory L.latLng(coords: Object): LatLng\r\n // Expects an plain object of the form `{lat: Number, lng: Number}` or `{lat: Number, lng: Number, alt: Number}` instead.\r\n\r\n function toLatLng(a, b, c) {\r\n \tif (a instanceof LatLng) {\r\n \t\treturn a;\r\n \t}\r\n \tif (isArray(a) && typeof a[0] !== 'object') {\r\n \t\tif (a.length === 3) {\r\n \t\t\treturn new LatLng(a[0], a[1], a[2]);\r\n \t\t}\r\n \t\tif (a.length === 2) {\r\n \t\t\treturn new LatLng(a[0], a[1]);\r\n \t\t}\r\n \t\treturn null;\r\n \t}\r\n \tif (a === undefined || a === null) {\r\n \t\treturn a;\r\n \t}\r\n \tif (typeof a === 'object' && 'lat' in a) {\r\n \t\treturn new LatLng(a.lat, 'lng' in a ? a.lng : a.lon, a.alt);\r\n \t}\r\n \tif (b === undefined) {\r\n \t\treturn null;\r\n \t}\r\n \treturn new LatLng(a, b, c);\r\n }\n\n /*\r\n * @namespace CRS\r\n * @crs L.CRS.Base\r\n * Object that defines coordinate reference systems for projecting\r\n * geographical points into pixel (screen) coordinates and back (and to\r\n * coordinates in other units for [WMS](https://en.wikipedia.org/wiki/Web_Map_Service) services). See\r\n * [spatial reference system](http://en.wikipedia.org/wiki/Coordinate_reference_system).\r\n *\r\n * Leaflet defines the most usual CRSs by default. If you want to use a\r\n * CRS not defined by default, take a look at the\r\n * [Proj4Leaflet](https://github.com/kartena/Proj4Leaflet) plugin.\r\n *\r\n * Note that the CRS instances do not inherit from Leaflet's `Class` object,\r\n * and can't be instantiated. Also, new classes can't inherit from them,\r\n * and methods can't be added to them with the `include` function.\r\n */\r\n\r\n var CRS = {\r\n \t// @method latLngToPoint(latlng: LatLng, zoom: Number): Point\r\n \t// Projects geographical coordinates into pixel coordinates for a given zoom.\r\n \tlatLngToPoint: function (latlng, zoom) {\r\n \t\tvar projectedPoint = this.projection.project(latlng),\r\n \t\t scale = this.scale(zoom);\r\n\r\n \t\treturn this.transformation._transform(projectedPoint, scale);\r\n \t},\r\n\r\n \t// @method pointToLatLng(point: Point, zoom: Number): LatLng\r\n \t// The inverse of `latLngToPoint`. Projects pixel coordinates on a given\r\n \t// zoom into geographical coordinates.\r\n \tpointToLatLng: function (point, zoom) {\r\n \t\tvar scale = this.scale(zoom),\r\n \t\t untransformedPoint = this.transformation.untransform(point, scale);\r\n\r\n \t\treturn this.projection.unproject(untransformedPoint);\r\n \t},\r\n\r\n \t// @method project(latlng: LatLng): Point\r\n \t// Projects geographical coordinates into coordinates in units accepted for\r\n \t// this CRS (e.g. meters for EPSG:3857, for passing it to WMS services).\r\n \tproject: function (latlng) {\r\n \t\treturn this.projection.project(latlng);\r\n \t},\r\n\r\n \t// @method unproject(point: Point): LatLng\r\n \t// Given a projected coordinate returns the corresponding LatLng.\r\n \t// The inverse of `project`.\r\n \tunproject: function (point) {\r\n \t\treturn this.projection.unproject(point);\r\n \t},\r\n\r\n \t// @method scale(zoom: Number): Number\r\n \t// Returns the scale used when transforming projected coordinates into\r\n \t// pixel coordinates for a particular zoom. For example, it returns\r\n \t// `256 * 2^zoom` for Mercator-based CRS.\r\n \tscale: function (zoom) {\r\n \t\treturn 256 * Math.pow(2, zoom);\r\n \t},\r\n\r\n \t// @method zoom(scale: Number): Number\r\n \t// Inverse of `scale()`, returns the zoom level corresponding to a scale\r\n \t// factor of `scale`.\r\n \tzoom: function (scale) {\r\n \t\treturn Math.log(scale / 256) / Math.LN2;\r\n \t},\r\n\r\n \t// @method getProjectedBounds(zoom: Number): Bounds\r\n \t// Returns the projection's bounds scaled and transformed for the provided `zoom`.\r\n \tgetProjectedBounds: function (zoom) {\r\n \t\tif (this.infinite) { return null; }\r\n\r\n \t\tvar b = this.projection.bounds,\r\n \t\t s = this.scale(zoom),\r\n \t\t min = this.transformation.transform(b.min, s),\r\n \t\t max = this.transformation.transform(b.max, s);\r\n\r\n \t\treturn new Bounds(min, max);\r\n \t},\r\n\r\n \t// @method distance(latlng1: LatLng, latlng2: LatLng): Number\r\n \t// Returns the distance between two geographical coordinates.\r\n\r\n \t// @property code: String\r\n \t// Standard code name of the CRS passed into WMS services (e.g. `'EPSG:3857'`)\r\n \t//\r\n \t// @property wrapLng: Number[]\r\n \t// An array of two numbers defining whether the longitude (horizontal) coordinate\r\n \t// axis wraps around a given range and how. Defaults to `[-180, 180]` in most\r\n \t// geographical CRSs. If `undefined`, the longitude axis does not wrap around.\r\n \t//\r\n \t// @property wrapLat: Number[]\r\n \t// Like `wrapLng`, but for the latitude (vertical) axis.\r\n\r\n \t// wrapLng: [min, max],\r\n \t// wrapLat: [min, max],\r\n\r\n \t// @property infinite: Boolean\r\n \t// If true, the coordinate space will be unbounded (infinite in both axes)\r\n \tinfinite: false,\r\n\r\n \t// @method wrapLatLng(latlng: LatLng): LatLng\r\n \t// Returns a `LatLng` where lat and lng has been wrapped according to the\r\n \t// CRS's `wrapLat` and `wrapLng` properties, if they are outside the CRS's bounds.\r\n \twrapLatLng: function (latlng) {\r\n \t\tvar lng = this.wrapLng ? wrapNum(latlng.lng, this.wrapLng, true) : latlng.lng,\r\n \t\t lat = this.wrapLat ? wrapNum(latlng.lat, this.wrapLat, true) : latlng.lat,\r\n \t\t alt = latlng.alt;\r\n\r\n \t\treturn new LatLng(lat, lng, alt);\r\n \t},\r\n\r\n \t// @method wrapLatLngBounds(bounds: LatLngBounds): LatLngBounds\r\n \t// Returns a `LatLngBounds` with the same size as the given one, ensuring\r\n \t// that its center is within the CRS's bounds.\r\n \t// Only accepts actual `L.LatLngBounds` instances, not arrays.\r\n \twrapLatLngBounds: function (bounds) {\r\n \t\tvar center = bounds.getCenter(),\r\n \t\t newCenter = this.wrapLatLng(center),\r\n \t\t latShift = center.lat - newCenter.lat,\r\n \t\t lngShift = center.lng - newCenter.lng;\r\n\r\n \t\tif (latShift === 0 && lngShift === 0) {\r\n \t\t\treturn bounds;\r\n \t\t}\r\n\r\n \t\tvar sw = bounds.getSouthWest(),\r\n \t\t ne = bounds.getNorthEast(),\r\n \t\t newSw = new LatLng(sw.lat - latShift, sw.lng - lngShift),\r\n \t\t newNe = new LatLng(ne.lat - latShift, ne.lng - lngShift);\r\n\r\n \t\treturn new LatLngBounds(newSw, newNe);\r\n \t}\r\n };\n\n /*\n * @namespace CRS\n * @crs L.CRS.Earth\n *\n * Serves as the base for CRS that are global such that they cover the earth.\n * Can only be used as the base for other CRS and cannot be used directly,\n * since it does not have a `code`, `projection` or `transformation`. `distance()` returns\n * meters.\n */\n\n var Earth = extend({}, CRS, {\n \twrapLng: [-180, 180],\n\n \t// Mean Earth Radius, as recommended for use by\n \t// the International Union of Geodesy and Geophysics,\n \t// see http://rosettacode.org/wiki/Haversine_formula\n \tR: 6371000,\n\n \t// distance between two geographical points using spherical law of cosines approximation\n \tdistance: function (latlng1, latlng2) {\n \t\tvar rad = Math.PI / 180,\n \t\t lat1 = latlng1.lat * rad,\n \t\t lat2 = latlng2.lat * rad,\n \t\t sinDLat = Math.sin((latlng2.lat - latlng1.lat) * rad / 2),\n \t\t sinDLon = Math.sin((latlng2.lng - latlng1.lng) * rad / 2),\n \t\t a = sinDLat * sinDLat + Math.cos(lat1) * Math.cos(lat2) * sinDLon * sinDLon,\n \t\t c = 2 * Math.atan2(Math.sqrt(a), Math.sqrt(1 - a));\n \t\treturn this.R * c;\n \t}\n });\n\n /*\r\n * @namespace Projection\r\n * @projection L.Projection.SphericalMercator\r\n *\r\n * Spherical Mercator projection — the most common projection for online maps,\r\n * used by almost all free and commercial tile providers. Assumes that Earth is\r\n * a sphere. Used by the `EPSG:3857` CRS.\r\n */\r\n\r\n var earthRadius = 6378137;\r\n\r\n var SphericalMercator = {\r\n\r\n \tR: earthRadius,\r\n \tMAX_LATITUDE: 85.0511287798,\r\n\r\n \tproject: function (latlng) {\r\n \t\tvar d = Math.PI / 180,\r\n \t\t max = this.MAX_LATITUDE,\r\n \t\t lat = Math.max(Math.min(max, latlng.lat), -max),\r\n \t\t sin = Math.sin(lat * d);\r\n\r\n \t\treturn new Point(\r\n \t\t\tthis.R * latlng.lng * d,\r\n \t\t\tthis.R * Math.log((1 + sin) / (1 - sin)) / 2);\r\n \t},\r\n\r\n \tunproject: function (point) {\r\n \t\tvar d = 180 / Math.PI;\r\n\r\n \t\treturn new LatLng(\r\n \t\t\t(2 * Math.atan(Math.exp(point.y / this.R)) - (Math.PI / 2)) * d,\r\n \t\t\tpoint.x * d / this.R);\r\n \t},\r\n\r\n \tbounds: (function () {\r\n \t\tvar d = earthRadius * Math.PI;\r\n \t\treturn new Bounds([-d, -d], [d, d]);\r\n \t})()\r\n };\n\n /*\r\n * @class Transformation\r\n * @aka L.Transformation\r\n *\r\n * Represents an affine transformation: a set of coefficients `a`, `b`, `c`, `d`\r\n * for transforming a point of a form `(x, y)` into `(a*x + b, c*y + d)` and doing\r\n * the reverse. Used by Leaflet in its projections code.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * var transformation = L.transformation(2, 5, -1, 10),\r\n * \tp = L.point(1, 2),\r\n * \tp2 = transformation.transform(p), // L.point(7, 8)\r\n * \tp3 = transformation.untransform(p2); // L.point(1, 2)\r\n * ```\r\n */\r\n\r\n\r\n // factory new L.Transformation(a: Number, b: Number, c: Number, d: Number)\r\n // Creates a `Transformation` object with the given coefficients.\r\n function Transformation(a, b, c, d) {\r\n \tif (isArray(a)) {\r\n \t\t// use array properties\r\n \t\tthis._a = a[0];\r\n \t\tthis._b = a[1];\r\n \t\tthis._c = a[2];\r\n \t\tthis._d = a[3];\r\n \t\treturn;\r\n \t}\r\n \tthis._a = a;\r\n \tthis._b = b;\r\n \tthis._c = c;\r\n \tthis._d = d;\r\n }\r\n\r\n Transformation.prototype = {\r\n \t// @method transform(point: Point, scale?: Number): Point\r\n \t// Returns a transformed point, optionally multiplied by the given scale.\r\n \t// Only accepts actual `L.Point` instances, not arrays.\r\n \ttransform: function (point, scale) { // (Point, Number) -> Point\r\n \t\treturn this._transform(point.clone(), scale);\r\n \t},\r\n\r\n \t// destructive transform (faster)\r\n \t_transform: function (point, scale) {\r\n \t\tscale = scale || 1;\r\n \t\tpoint.x = scale * (this._a * point.x + this._b);\r\n \t\tpoint.y = scale * (this._c * point.y + this._d);\r\n \t\treturn point;\r\n \t},\r\n\r\n \t// @method untransform(point: Point, scale?: Number): Point\r\n \t// Returns the reverse transformation of the given point, optionally divided\r\n \t// by the given scale. Only accepts actual `L.Point` instances, not arrays.\r\n \tuntransform: function (point, scale) {\r\n \t\tscale = scale || 1;\r\n \t\treturn new Point(\r\n \t\t (point.x / scale - this._b) / this._a,\r\n \t\t (point.y / scale - this._d) / this._c);\r\n \t}\r\n };\r\n\r\n // factory L.transformation(a: Number, b: Number, c: Number, d: Number)\r\n\r\n // @factory L.transformation(a: Number, b: Number, c: Number, d: Number)\r\n // Instantiates a Transformation object with the given coefficients.\r\n\r\n // @alternative\r\n // @factory L.transformation(coefficients: Array): Transformation\r\n // Expects an coefficients array of the form\r\n // `[a: Number, b: Number, c: Number, d: Number]`.\r\n\r\n function toTransformation(a, b, c, d) {\r\n \treturn new Transformation(a, b, c, d);\r\n }\n\n /*\r\n * @namespace CRS\r\n * @crs L.CRS.EPSG3857\r\n *\r\n * The most common CRS for online maps, used by almost all free and commercial\r\n * tile providers. Uses Spherical Mercator projection. Set in by default in\r\n * Map's `crs` option.\r\n */\r\n\r\n var EPSG3857 = extend({}, Earth, {\r\n \tcode: 'EPSG:3857',\r\n \tprojection: SphericalMercator,\r\n\r\n \ttransformation: (function () {\r\n \t\tvar scale = 0.5 / (Math.PI * SphericalMercator.R);\r\n \t\treturn toTransformation(scale, 0.5, -scale, 0.5);\r\n \t}())\r\n });\r\n\r\n var EPSG900913 = extend({}, EPSG3857, {\r\n \tcode: 'EPSG:900913'\r\n });\n\n // @namespace SVG; @section\n // There are several static functions which can be called without instantiating L.SVG:\n\n // @function create(name: String): SVGElement\n // Returns a instance of [SVGElement](https://developer.mozilla.org/docs/Web/API/SVGElement),\n // corresponding to the class name passed. For example, using 'line' will return\n // an instance of [SVGLineElement](https://developer.mozilla.org/docs/Web/API/SVGLineElement).\n function svgCreate(name) {\n \treturn document.createElementNS('http://www.w3.org/2000/svg', name);\n }\n\n // @function pointsToPath(rings: Point[], closed: Boolean): String\n // Generates a SVG path string for multiple rings, with each ring turning\n // into \"M..L..L..\" instructions\n function pointsToPath(rings, closed) {\n \tvar str = '',\n \ti, j, len, len2, points, p;\n\n \tfor (i = 0, len = rings.length; i < len; i++) {\n \t\tpoints = rings[i];\n\n \t\tfor (j = 0, len2 = points.length; j < len2; j++) {\n \t\t\tp = points[j];\n \t\t\tstr += (j ? 'L' : 'M') + p.x + ' ' + p.y;\n \t\t}\n\n \t\t// closes the ring for polygons; \"x\" is VML syntax\n \t\tstr += closed ? (svg ? 'z' : 'x') : '';\n \t}\n\n \t// SVG complains about empty path strings\n \treturn str || 'M0 0';\n }\n\n /*\r\n * @namespace Browser\r\n * @aka L.Browser\r\n *\r\n * A namespace with static properties for browser/feature detection used by Leaflet internally.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * if (L.Browser.ielt9) {\r\n * alert('Upgrade your browser, dude!');\r\n * }\r\n * ```\r\n */\r\n\r\n var style$1 = document.documentElement.style;\r\n\r\n // @property ie: Boolean; `true` for all Internet Explorer versions (not Edge).\r\n var ie = 'ActiveXObject' in window;\r\n\r\n // @property ielt9: Boolean; `true` for Internet Explorer versions less than 9.\r\n var ielt9 = ie && !document.addEventListener;\r\n\r\n // @property edge: Boolean; `true` for the Edge web browser.\r\n var edge = 'msLaunchUri' in navigator && !('documentMode' in document);\r\n\r\n // @property webkit: Boolean;\r\n // `true` for webkit-based browsers like Chrome and Safari (including mobile versions).\r\n var webkit = userAgentContains('webkit');\r\n\r\n // @property android: Boolean\r\n // `true` for any browser running on an Android platform.\r\n var android = userAgentContains('android');\r\n\r\n // @property android23: Boolean; `true` for browsers running on Android 2 or Android 3.\r\n var android23 = userAgentContains('android 2') || userAgentContains('android 3');\r\n\r\n /* See https://stackoverflow.com/a/17961266 for details on detecting stock Android */\r\n var webkitVer = parseInt(/WebKit\\/([0-9]+)|$/.exec(navigator.userAgent)[1], 10); // also matches AppleWebKit\r\n // @property androidStock: Boolean; `true` for the Android stock browser (i.e. not Chrome)\r\n var androidStock = android && userAgentContains('Google') && webkitVer < 537 && !('AudioNode' in window);\r\n\r\n // @property opera: Boolean; `true` for the Opera browser\r\n var opera = !!window.opera;\r\n\r\n // @property chrome: Boolean; `true` for the Chrome browser.\r\n var chrome = !edge && userAgentContains('chrome');\r\n\r\n // @property gecko: Boolean; `true` for gecko-based browsers like Firefox.\r\n var gecko = userAgentContains('gecko') && !webkit && !opera && !ie;\r\n\r\n // @property safari: Boolean; `true` for the Safari browser.\r\n var safari = !chrome && userAgentContains('safari');\r\n\r\n var phantom = userAgentContains('phantom');\r\n\r\n // @property opera12: Boolean\r\n // `true` for the Opera browser supporting CSS transforms (version 12 or later).\r\n var opera12 = 'OTransition' in style$1;\r\n\r\n // @property win: Boolean; `true` when the browser is running in a Windows platform\r\n var win = navigator.platform.indexOf('Win') === 0;\r\n\r\n // @property ie3d: Boolean; `true` for all Internet Explorer versions supporting CSS transforms.\r\n var ie3d = ie && ('transition' in style$1);\r\n\r\n // @property webkit3d: Boolean; `true` for webkit-based browsers supporting CSS transforms.\r\n var webkit3d = ('WebKitCSSMatrix' in window) && ('m11' in new window.WebKitCSSMatrix()) && !android23;\r\n\r\n // @property gecko3d: Boolean; `true` for gecko-based browsers supporting CSS transforms.\r\n var gecko3d = 'MozPerspective' in style$1;\r\n\r\n // @property any3d: Boolean\r\n // `true` for all browsers supporting CSS transforms.\r\n var any3d = !window.L_DISABLE_3D && (ie3d || webkit3d || gecko3d) && !opera12 && !phantom;\r\n\r\n // @property mobile: Boolean; `true` for all browsers running in a mobile device.\r\n var mobile = typeof orientation !== 'undefined' || userAgentContains('mobile');\r\n\r\n // @property mobileWebkit: Boolean; `true` for all webkit-based browsers in a mobile device.\r\n var mobileWebkit = mobile && webkit;\r\n\r\n // @property mobileWebkit3d: Boolean\r\n // `true` for all webkit-based browsers in a mobile device supporting CSS transforms.\r\n var mobileWebkit3d = mobile && webkit3d;\r\n\r\n // @property msPointer: Boolean\r\n // `true` for browsers implementing the Microsoft touch events model (notably IE10).\r\n var msPointer = !window.PointerEvent && window.MSPointerEvent;\r\n\r\n // @property pointer: Boolean\r\n // `true` for all browsers supporting [pointer events](https://msdn.microsoft.com/en-us/library/dn433244%28v=vs.85%29.aspx).\r\n var pointer = !!(window.PointerEvent || msPointer);\r\n\r\n // @property touch: Boolean\r\n // `true` for all browsers supporting [touch events](https://developer.mozilla.org/docs/Web/API/Touch_events).\r\n // This does not necessarily mean that the browser is running in a computer with\r\n // a touchscreen, it only means that the browser is capable of understanding\r\n // touch events.\r\n var touch = !window.L_NO_TOUCH && (pointer || 'ontouchstart' in window ||\r\n \t\t(window.DocumentTouch && document instanceof window.DocumentTouch));\r\n\r\n // @property mobileOpera: Boolean; `true` for the Opera browser in a mobile device.\r\n var mobileOpera = mobile && opera;\r\n\r\n // @property mobileGecko: Boolean\r\n // `true` for gecko-based browsers running in a mobile device.\r\n var mobileGecko = mobile && gecko;\r\n\r\n // @property retina: Boolean\r\n // `true` for browsers on a high-resolution \"retina\" screen or on any screen when browser's display zoom is more than 100%.\r\n var retina = (window.devicePixelRatio || (window.screen.deviceXDPI / window.screen.logicalXDPI)) > 1;\r\n\r\n // @property passiveEvents: Boolean\r\n // `true` for browsers that support passive events.\r\n var passiveEvents = (function () {\r\n \tvar supportsPassiveOption = false;\r\n \ttry {\r\n \t\tvar opts = Object.defineProperty({}, 'passive', {\r\n \t\t\tget: function () { // eslint-disable-line getter-return\r\n \t\t\t\tsupportsPassiveOption = true;\r\n \t\t\t}\r\n \t\t});\r\n \t\twindow.addEventListener('testPassiveEventSupport', falseFn, opts);\r\n \t\twindow.removeEventListener('testPassiveEventSupport', falseFn, opts);\r\n \t} catch (e) {\r\n \t\t// Errors can safely be ignored since this is only a browser support test.\r\n \t}\r\n \treturn supportsPassiveOption;\r\n }());\r\n\r\n // @property canvas: Boolean\r\n // `true` when the browser supports [``](https://developer.mozilla.org/docs/Web/API/Canvas_API).\r\n var canvas = (function () {\r\n \treturn !!document.createElement('canvas').getContext;\r\n }());\r\n\r\n // @property svg: Boolean\r\n // `true` when the browser supports [SVG](https://developer.mozilla.org/docs/Web/SVG).\r\n var svg = !!(document.createElementNS && svgCreate('svg').createSVGRect);\r\n\r\n // @property vml: Boolean\r\n // `true` if the browser supports [VML](https://en.wikipedia.org/wiki/Vector_Markup_Language).\r\n var vml = !svg && (function () {\r\n \ttry {\r\n \t\tvar div = document.createElement('div');\r\n \t\tdiv.innerHTML = '';\r\n\r\n \t\tvar shape = div.firstChild;\r\n \t\tshape.style.behavior = 'url(#default#VML)';\r\n\r\n \t\treturn shape && (typeof shape.adj === 'object');\r\n\r\n \t} catch (e) {\r\n \t\treturn false;\r\n \t}\r\n }());\r\n\r\n\r\n function userAgentContains(str) {\r\n \treturn navigator.userAgent.toLowerCase().indexOf(str) >= 0;\r\n }\n\n var Browser = ({\n ie: ie,\n ielt9: ielt9,\n edge: edge,\n webkit: webkit,\n android: android,\n android23: android23,\n androidStock: androidStock,\n opera: opera,\n chrome: chrome,\n gecko: gecko,\n safari: safari,\n phantom: phantom,\n opera12: opera12,\n win: win,\n ie3d: ie3d,\n webkit3d: webkit3d,\n gecko3d: gecko3d,\n any3d: any3d,\n mobile: mobile,\n mobileWebkit: mobileWebkit,\n mobileWebkit3d: mobileWebkit3d,\n msPointer: msPointer,\n pointer: pointer,\n touch: touch,\n mobileOpera: mobileOpera,\n mobileGecko: mobileGecko,\n retina: retina,\n passiveEvents: passiveEvents,\n canvas: canvas,\n svg: svg,\n vml: vml\n });\n\n /*\n * Extends L.DomEvent to provide touch support for Internet Explorer and Windows-based devices.\n */\n\n\n var POINTER_DOWN = msPointer ? 'MSPointerDown' : 'pointerdown';\n var POINTER_MOVE = msPointer ? 'MSPointerMove' : 'pointermove';\n var POINTER_UP = msPointer ? 'MSPointerUp' : 'pointerup';\n var POINTER_CANCEL = msPointer ? 'MSPointerCancel' : 'pointercancel';\n\n var _pointers = {};\n var _pointerDocListener = false;\n\n // Provides a touch events wrapper for (ms)pointer events.\n // ref http://www.w3.org/TR/pointerevents/ https://www.w3.org/Bugs/Public/show_bug.cgi?id=22890\n\n function addPointerListener(obj, type, handler, id) {\n \tif (type === 'touchstart') {\n \t\t_addPointerStart(obj, handler, id);\n\n \t} else if (type === 'touchmove') {\n \t\t_addPointerMove(obj, handler, id);\n\n \t} else if (type === 'touchend') {\n \t\t_addPointerEnd(obj, handler, id);\n \t}\n\n \treturn this;\n }\n\n function removePointerListener(obj, type, id) {\n \tvar handler = obj['_leaflet_' + type + id];\n\n \tif (type === 'touchstart') {\n \t\tobj.removeEventListener(POINTER_DOWN, handler, false);\n\n \t} else if (type === 'touchmove') {\n \t\tobj.removeEventListener(POINTER_MOVE, handler, false);\n\n \t} else if (type === 'touchend') {\n \t\tobj.removeEventListener(POINTER_UP, handler, false);\n \t\tobj.removeEventListener(POINTER_CANCEL, handler, false);\n \t}\n\n \treturn this;\n }\n\n function _addPointerStart(obj, handler, id) {\n \tvar onDown = bind(function (e) {\n \t\t// IE10 specific: MsTouch needs preventDefault. See #2000\n \t\tif (e.MSPOINTER_TYPE_TOUCH && e.pointerType === e.MSPOINTER_TYPE_TOUCH) {\n \t\t\tpreventDefault(e);\n \t\t}\n\n \t\t_handlePointer(e, handler);\n \t});\n\n \tobj['_leaflet_touchstart' + id] = onDown;\n \tobj.addEventListener(POINTER_DOWN, onDown, false);\n\n \t// need to keep track of what pointers and how many are active to provide e.touches emulation\n \tif (!_pointerDocListener) {\n \t\t// we listen document as any drags that end by moving the touch off the screen get fired there\n \t\tdocument.addEventListener(POINTER_DOWN, _globalPointerDown, true);\n \t\tdocument.addEventListener(POINTER_MOVE, _globalPointerMove, true);\n \t\tdocument.addEventListener(POINTER_UP, _globalPointerUp, true);\n \t\tdocument.addEventListener(POINTER_CANCEL, _globalPointerUp, true);\n\n \t\t_pointerDocListener = true;\n \t}\n }\n\n function _globalPointerDown(e) {\n \t_pointers[e.pointerId] = e;\n }\n\n function _globalPointerMove(e) {\n \tif (_pointers[e.pointerId]) {\n \t\t_pointers[e.pointerId] = e;\n \t}\n }\n\n function _globalPointerUp(e) {\n \tdelete _pointers[e.pointerId];\n }\n\n function _handlePointer(e, handler) {\n \te.touches = [];\n \tfor (var i in _pointers) {\n \t\te.touches.push(_pointers[i]);\n \t}\n \te.changedTouches = [e];\n\n \thandler(e);\n }\n\n function _addPointerMove(obj, handler, id) {\n \tvar onMove = function (e) {\n \t\t// don't fire touch moves when mouse isn't down\n \t\tif ((e.pointerType === (e.MSPOINTER_TYPE_MOUSE || 'mouse')) && e.buttons === 0) {\n \t\t\treturn;\n \t\t}\n\n \t\t_handlePointer(e, handler);\n \t};\n\n \tobj['_leaflet_touchmove' + id] = onMove;\n \tobj.addEventListener(POINTER_MOVE, onMove, false);\n }\n\n function _addPointerEnd(obj, handler, id) {\n \tvar onUp = function (e) {\n \t\t_handlePointer(e, handler);\n \t};\n\n \tobj['_leaflet_touchend' + id] = onUp;\n \tobj.addEventListener(POINTER_UP, onUp, false);\n \tobj.addEventListener(POINTER_CANCEL, onUp, false);\n }\n\n /*\r\n * Extends the event handling code with double tap support for mobile browsers.\r\n */\r\n\r\n var _touchstart = msPointer ? 'MSPointerDown' : pointer ? 'pointerdown' : 'touchstart';\r\n var _touchend = msPointer ? 'MSPointerUp' : pointer ? 'pointerup' : 'touchend';\r\n var _pre = '_leaflet_';\r\n\r\n // inspired by Zepto touch code by Thomas Fuchs\r\n function addDoubleTapListener(obj, handler, id) {\r\n \tvar last, touch$$1,\r\n \t doubleTap = false,\r\n \t delay = 250;\r\n\r\n \tfunction onTouchStart(e) {\r\n\r\n \t\tif (pointer) {\r\n \t\t\tif (!e.isPrimary) { return; }\r\n \t\t\tif (e.pointerType === 'mouse') { return; } // mouse fires native dblclick\r\n \t\t} else if (e.touches.length > 1) {\r\n \t\t\treturn;\r\n \t\t}\r\n\r\n \t\tvar now = Date.now(),\r\n \t\t delta = now - (last || now);\r\n\r\n \t\ttouch$$1 = e.touches ? e.touches[0] : e;\r\n \t\tdoubleTap = (delta > 0 && delta <= delay);\r\n \t\tlast = now;\r\n \t}\r\n\r\n \tfunction onTouchEnd(e) {\r\n \t\tif (doubleTap && !touch$$1.cancelBubble) {\r\n \t\t\tif (pointer) {\r\n \t\t\t\tif (e.pointerType === 'mouse') { return; }\r\n \t\t\t\t// work around .type being readonly with MSPointer* events\r\n \t\t\t\tvar newTouch = {},\r\n \t\t\t\t prop, i;\r\n\r\n \t\t\t\tfor (i in touch$$1) {\r\n \t\t\t\t\tprop = touch$$1[i];\r\n \t\t\t\t\tnewTouch[i] = prop && prop.bind ? prop.bind(touch$$1) : prop;\r\n \t\t\t\t}\r\n \t\t\t\ttouch$$1 = newTouch;\r\n \t\t\t}\r\n \t\t\ttouch$$1.type = 'dblclick';\r\n \t\t\ttouch$$1.button = 0;\r\n \t\t\thandler(touch$$1);\r\n \t\t\tlast = null;\r\n \t\t}\r\n \t}\r\n\r\n \tobj[_pre + _touchstart + id] = onTouchStart;\r\n \tobj[_pre + _touchend + id] = onTouchEnd;\r\n \tobj[_pre + 'dblclick' + id] = handler;\r\n\r\n \tobj.addEventListener(_touchstart, onTouchStart, passiveEvents ? {passive: false} : false);\r\n \tobj.addEventListener(_touchend, onTouchEnd, passiveEvents ? {passive: false} : false);\r\n\r\n \t// On some platforms (notably, chrome<55 on win10 + touchscreen + mouse),\r\n \t// the browser doesn't fire touchend/pointerup events but does fire\r\n \t// native dblclicks. See #4127.\r\n \t// Edge 14 also fires native dblclicks, but only for pointerType mouse, see #5180.\r\n \tobj.addEventListener('dblclick', handler, false);\r\n\r\n \treturn this;\r\n }\r\n\r\n function removeDoubleTapListener(obj, id) {\r\n \tvar touchstart = obj[_pre + _touchstart + id],\r\n \t touchend = obj[_pre + _touchend + id],\r\n \t dblclick = obj[_pre + 'dblclick' + id];\r\n\r\n \tobj.removeEventListener(_touchstart, touchstart, passiveEvents ? {passive: false} : false);\r\n \tobj.removeEventListener(_touchend, touchend, passiveEvents ? {passive: false} : false);\r\n \tobj.removeEventListener('dblclick', dblclick, false);\r\n\r\n \treturn this;\r\n }\n\n /*\r\n * @namespace DomUtil\r\n *\r\n * Utility functions to work with the [DOM](https://developer.mozilla.org/docs/Web/API/Document_Object_Model)\r\n * tree, used by Leaflet internally.\r\n *\r\n * Most functions expecting or returning a `HTMLElement` also work for\r\n * SVG elements. The only difference is that classes refer to CSS classes\r\n * in HTML and SVG classes in SVG.\r\n */\r\n\r\n\r\n // @property TRANSFORM: String\r\n // Vendor-prefixed transform style name (e.g. `'webkitTransform'` for WebKit).\r\n var TRANSFORM = testProp(\r\n \t['transform', 'webkitTransform', 'OTransform', 'MozTransform', 'msTransform']);\r\n\r\n // webkitTransition comes first because some browser versions that drop vendor prefix don't do\r\n // the same for the transitionend event, in particular the Android 4.1 stock browser\r\n\r\n // @property TRANSITION: String\r\n // Vendor-prefixed transition style name.\r\n var TRANSITION = testProp(\r\n \t['webkitTransition', 'transition', 'OTransition', 'MozTransition', 'msTransition']);\r\n\r\n // @property TRANSITION_END: String\r\n // Vendor-prefixed transitionend event name.\r\n var TRANSITION_END =\r\n \tTRANSITION === 'webkitTransition' || TRANSITION === 'OTransition' ? TRANSITION + 'End' : 'transitionend';\r\n\r\n\r\n // @function get(id: String|HTMLElement): HTMLElement\r\n // Returns an element given its DOM id, or returns the element itself\r\n // if it was passed directly.\r\n function get(id) {\r\n \treturn typeof id === 'string' ? document.getElementById(id) : id;\r\n }\r\n\r\n // @function getStyle(el: HTMLElement, styleAttrib: String): String\r\n // Returns the value for a certain style attribute on an element,\r\n // including computed values or values set through CSS.\r\n function getStyle(el, style) {\r\n \tvar value = el.style[style] || (el.currentStyle && el.currentStyle[style]);\r\n\r\n \tif ((!value || value === 'auto') && document.defaultView) {\r\n \t\tvar css = document.defaultView.getComputedStyle(el, null);\r\n \t\tvalue = css ? css[style] : null;\r\n \t}\r\n \treturn value === 'auto' ? null : value;\r\n }\r\n\r\n // @function create(tagName: String, className?: String, container?: HTMLElement): HTMLElement\r\n // Creates an HTML element with `tagName`, sets its class to `className`, and optionally appends it to `container` element.\r\n function create$1(tagName, className, container) {\r\n \tvar el = document.createElement(tagName);\r\n \tel.className = className || '';\r\n\r\n \tif (container) {\r\n \t\tcontainer.appendChild(el);\r\n \t}\r\n \treturn el;\r\n }\r\n\r\n // @function remove(el: HTMLElement)\r\n // Removes `el` from its parent element\r\n function remove(el) {\r\n \tvar parent = el.parentNode;\r\n \tif (parent) {\r\n \t\tparent.removeChild(el);\r\n \t}\r\n }\r\n\r\n // @function empty(el: HTMLElement)\r\n // Removes all of `el`'s children elements from `el`\r\n function empty(el) {\r\n \twhile (el.firstChild) {\r\n \t\tel.removeChild(el.firstChild);\r\n \t}\r\n }\r\n\r\n // @function toFront(el: HTMLElement)\r\n // Makes `el` the last child of its parent, so it renders in front of the other children.\r\n function toFront(el) {\r\n \tvar parent = el.parentNode;\r\n \tif (parent && parent.lastChild !== el) {\r\n \t\tparent.appendChild(el);\r\n \t}\r\n }\r\n\r\n // @function toBack(el: HTMLElement)\r\n // Makes `el` the first child of its parent, so it renders behind the other children.\r\n function toBack(el) {\r\n \tvar parent = el.parentNode;\r\n \tif (parent && parent.firstChild !== el) {\r\n \t\tparent.insertBefore(el, parent.firstChild);\r\n \t}\r\n }\r\n\r\n // @function hasClass(el: HTMLElement, name: String): Boolean\r\n // Returns `true` if the element's class attribute contains `name`.\r\n function hasClass(el, name) {\r\n \tif (el.classList !== undefined) {\r\n \t\treturn el.classList.contains(name);\r\n \t}\r\n \tvar className = getClass(el);\r\n \treturn className.length > 0 && new RegExp('(^|\\\\s)' + name + '(\\\\s|$)').test(className);\r\n }\r\n\r\n // @function addClass(el: HTMLElement, name: String)\r\n // Adds `name` to the element's class attribute.\r\n function addClass(el, name) {\r\n \tif (el.classList !== undefined) {\r\n \t\tvar classes = splitWords(name);\r\n \t\tfor (var i = 0, len = classes.length; i < len; i++) {\r\n \t\t\tel.classList.add(classes[i]);\r\n \t\t}\r\n \t} else if (!hasClass(el, name)) {\r\n \t\tvar className = getClass(el);\r\n \t\tsetClass(el, (className ? className + ' ' : '') + name);\r\n \t}\r\n }\r\n\r\n // @function removeClass(el: HTMLElement, name: String)\r\n // Removes `name` from the element's class attribute.\r\n function removeClass(el, name) {\r\n \tif (el.classList !== undefined) {\r\n \t\tel.classList.remove(name);\r\n \t} else {\r\n \t\tsetClass(el, trim((' ' + getClass(el) + ' ').replace(' ' + name + ' ', ' ')));\r\n \t}\r\n }\r\n\r\n // @function setClass(el: HTMLElement, name: String)\r\n // Sets the element's class.\r\n function setClass(el, name) {\r\n \tif (el.className.baseVal === undefined) {\r\n \t\tel.className = name;\r\n \t} else {\r\n \t\t// in case of SVG element\r\n \t\tel.className.baseVal = name;\r\n \t}\r\n }\r\n\r\n // @function getClass(el: HTMLElement): String\r\n // Returns the element's class.\r\n function getClass(el) {\r\n \t// Check if the element is an SVGElementInstance and use the correspondingElement instead\r\n \t// (Required for linked SVG elements in IE11.)\r\n \tif (el.correspondingElement) {\r\n \t\tel = el.correspondingElement;\r\n \t}\r\n \treturn el.className.baseVal === undefined ? el.className : el.className.baseVal;\r\n }\r\n\r\n // @function setOpacity(el: HTMLElement, opacity: Number)\r\n // Set the opacity of an element (including old IE support).\r\n // `opacity` must be a number from `0` to `1`.\r\n function setOpacity(el, value) {\r\n \tif ('opacity' in el.style) {\r\n \t\tel.style.opacity = value;\r\n \t} else if ('filter' in el.style) {\r\n \t\t_setOpacityIE(el, value);\r\n \t}\r\n }\r\n\r\n function _setOpacityIE(el, value) {\r\n \tvar filter = false,\r\n \t filterName = 'DXImageTransform.Microsoft.Alpha';\r\n\r\n \t// filters collection throws an error if we try to retrieve a filter that doesn't exist\r\n \ttry {\r\n \t\tfilter = el.filters.item(filterName);\r\n \t} catch (e) {\r\n \t\t// don't set opacity to 1 if we haven't already set an opacity,\r\n \t\t// it isn't needed and breaks transparent pngs.\r\n \t\tif (value === 1) { return; }\r\n \t}\r\n\r\n \tvalue = Math.round(value * 100);\r\n\r\n \tif (filter) {\r\n \t\tfilter.Enabled = (value !== 100);\r\n \t\tfilter.Opacity = value;\r\n \t} else {\r\n \t\tel.style.filter += ' progid:' + filterName + '(opacity=' + value + ')';\r\n \t}\r\n }\r\n\r\n // @function testProp(props: String[]): String|false\r\n // Goes through the array of style names and returns the first name\r\n // that is a valid style name for an element. If no such name is found,\r\n // it returns false. Useful for vendor-prefixed styles like `transform`.\r\n function testProp(props) {\r\n \tvar style = document.documentElement.style;\r\n\r\n \tfor (var i = 0; i < props.length; i++) {\r\n \t\tif (props[i] in style) {\r\n \t\t\treturn props[i];\r\n \t\t}\r\n \t}\r\n \treturn false;\r\n }\r\n\r\n // @function setTransform(el: HTMLElement, offset: Point, scale?: Number)\r\n // Resets the 3D CSS transform of `el` so it is translated by `offset` pixels\r\n // and optionally scaled by `scale`. Does not have an effect if the\r\n // browser doesn't support 3D CSS transforms.\r\n function setTransform(el, offset, scale) {\r\n \tvar pos = offset || new Point(0, 0);\r\n\r\n \tel.style[TRANSFORM] =\r\n \t\t(ie3d ?\r\n \t\t\t'translate(' + pos.x + 'px,' + pos.y + 'px)' :\r\n \t\t\t'translate3d(' + pos.x + 'px,' + pos.y + 'px,0)') +\r\n \t\t(scale ? ' scale(' + scale + ')' : '');\r\n }\r\n\r\n // @function setPosition(el: HTMLElement, position: Point)\r\n // Sets the position of `el` to coordinates specified by `position`,\r\n // using CSS translate or top/left positioning depending on the browser\r\n // (used by Leaflet internally to position its layers).\r\n function setPosition(el, point) {\r\n\r\n \t/*eslint-disable */\r\n \tel._leaflet_pos = point;\r\n \t/* eslint-enable */\r\n\r\n \tif (any3d) {\r\n \t\tsetTransform(el, point);\r\n \t} else {\r\n \t\tel.style.left = point.x + 'px';\r\n \t\tel.style.top = point.y + 'px';\r\n \t}\r\n }\r\n\r\n // @function getPosition(el: HTMLElement): Point\r\n // Returns the coordinates of an element previously positioned with setPosition.\r\n function getPosition(el) {\r\n \t// this method is only used for elements previously positioned using setPosition,\r\n \t// so it's safe to cache the position for performance\r\n\r\n \treturn el._leaflet_pos || new Point(0, 0);\r\n }\r\n\r\n // @function disableTextSelection()\r\n // Prevents the user from generating `selectstart` DOM events, usually generated\r\n // when the user drags the mouse through a page with text. Used internally\r\n // by Leaflet to override the behaviour of any click-and-drag interaction on\r\n // the map. Affects drag interactions on the whole document.\r\n\r\n // @function enableTextSelection()\r\n // Cancels the effects of a previous [`L.DomUtil.disableTextSelection`](#domutil-disabletextselection).\r\n var disableTextSelection;\r\n var enableTextSelection;\r\n var _userSelect;\r\n if ('onselectstart' in document) {\r\n \tdisableTextSelection = function () {\r\n \t\ton(window, 'selectstart', preventDefault);\r\n \t};\r\n \tenableTextSelection = function () {\r\n \t\toff(window, 'selectstart', preventDefault);\r\n \t};\r\n } else {\r\n \tvar userSelectProperty = testProp(\r\n \t\t['userSelect', 'WebkitUserSelect', 'OUserSelect', 'MozUserSelect', 'msUserSelect']);\r\n\r\n \tdisableTextSelection = function () {\r\n \t\tif (userSelectProperty) {\r\n \t\t\tvar style = document.documentElement.style;\r\n \t\t\t_userSelect = style[userSelectProperty];\r\n \t\t\tstyle[userSelectProperty] = 'none';\r\n \t\t}\r\n \t};\r\n \tenableTextSelection = function () {\r\n \t\tif (userSelectProperty) {\r\n \t\t\tdocument.documentElement.style[userSelectProperty] = _userSelect;\r\n \t\t\t_userSelect = undefined;\r\n \t\t}\r\n \t};\r\n }\r\n\r\n // @function disableImageDrag()\r\n // As [`L.DomUtil.disableTextSelection`](#domutil-disabletextselection), but\r\n // for `dragstart` DOM events, usually generated when the user drags an image.\r\n function disableImageDrag() {\r\n \ton(window, 'dragstart', preventDefault);\r\n }\r\n\r\n // @function enableImageDrag()\r\n // Cancels the effects of a previous [`L.DomUtil.disableImageDrag`](#domutil-disabletextselection).\r\n function enableImageDrag() {\r\n \toff(window, 'dragstart', preventDefault);\r\n }\r\n\r\n var _outlineElement, _outlineStyle;\r\n // @function preventOutline(el: HTMLElement)\r\n // Makes the [outline](https://developer.mozilla.org/docs/Web/CSS/outline)\r\n // of the element `el` invisible. Used internally by Leaflet to prevent\r\n // focusable elements from displaying an outline when the user performs a\r\n // drag interaction on them.\r\n function preventOutline(element) {\r\n \twhile (element.tabIndex === -1) {\r\n \t\telement = element.parentNode;\r\n \t}\r\n \tif (!element.style) { return; }\r\n \trestoreOutline();\r\n \t_outlineElement = element;\r\n \t_outlineStyle = element.style.outline;\r\n \telement.style.outline = 'none';\r\n \ton(window, 'keydown', restoreOutline);\r\n }\r\n\r\n // @function restoreOutline()\r\n // Cancels the effects of a previous [`L.DomUtil.preventOutline`]().\r\n function restoreOutline() {\r\n \tif (!_outlineElement) { return; }\r\n \t_outlineElement.style.outline = _outlineStyle;\r\n \t_outlineElement = undefined;\r\n \t_outlineStyle = undefined;\r\n \toff(window, 'keydown', restoreOutline);\r\n }\r\n\r\n // @function getSizedParentNode(el: HTMLElement): HTMLElement\r\n // Finds the closest parent node which size (width and height) is not null.\r\n function getSizedParentNode(element) {\r\n \tdo {\r\n \t\telement = element.parentNode;\r\n \t} while ((!element.offsetWidth || !element.offsetHeight) && element !== document.body);\r\n \treturn element;\r\n }\r\n\r\n // @function getScale(el: HTMLElement): Object\r\n // Computes the CSS scale currently applied on the element.\r\n // Returns an object with `x` and `y` members as horizontal and vertical scales respectively,\r\n // and `boundingClientRect` as the result of [`getBoundingClientRect()`](https://developer.mozilla.org/en-US/docs/Web/API/Element/getBoundingClientRect).\r\n function getScale(element) {\r\n \tvar rect = element.getBoundingClientRect(); // Read-only in old browsers.\r\n\r\n \treturn {\r\n \t\tx: rect.width / element.offsetWidth || 1,\r\n \t\ty: rect.height / element.offsetHeight || 1,\r\n \t\tboundingClientRect: rect\r\n \t};\r\n }\n\n var DomUtil = ({\n TRANSFORM: TRANSFORM,\n TRANSITION: TRANSITION,\n TRANSITION_END: TRANSITION_END,\n get: get,\n getStyle: getStyle,\n create: create$1,\n remove: remove,\n empty: empty,\n toFront: toFront,\n toBack: toBack,\n hasClass: hasClass,\n addClass: addClass,\n removeClass: removeClass,\n setClass: setClass,\n getClass: getClass,\n setOpacity: setOpacity,\n testProp: testProp,\n setTransform: setTransform,\n setPosition: setPosition,\n getPosition: getPosition,\n disableTextSelection: disableTextSelection,\n enableTextSelection: enableTextSelection,\n disableImageDrag: disableImageDrag,\n enableImageDrag: enableImageDrag,\n preventOutline: preventOutline,\n restoreOutline: restoreOutline,\n getSizedParentNode: getSizedParentNode,\n getScale: getScale\n });\n\n /*\r\n * @namespace DomEvent\r\n * Utility functions to work with the [DOM events](https://developer.mozilla.org/docs/Web/API/Event), used by Leaflet internally.\r\n */\r\n\r\n // Inspired by John Resig, Dean Edwards and YUI addEvent implementations.\r\n\r\n // @function on(el: HTMLElement, types: String, fn: Function, context?: Object): this\r\n // Adds a listener function (`fn`) to a particular DOM event type of the\r\n // element `el`. You can optionally specify the context of the listener\r\n // (object the `this` keyword will point to). You can also pass several\r\n // space-separated types (e.g. `'click dblclick'`).\r\n\r\n // @alternative\r\n // @function on(el: HTMLElement, eventMap: Object, context?: Object): this\r\n // Adds a set of type/listener pairs, e.g. `{click: onClick, mousemove: onMouseMove}`\r\n function on(obj, types, fn, context) {\r\n\r\n \tif (typeof types === 'object') {\r\n \t\tfor (var type in types) {\r\n \t\t\taddOne(obj, type, types[type], fn);\r\n \t\t}\r\n \t} else {\r\n \t\ttypes = splitWords(types);\r\n\r\n \t\tfor (var i = 0, len = types.length; i < len; i++) {\r\n \t\t\taddOne(obj, types[i], fn, context);\r\n \t\t}\r\n \t}\r\n\r\n \treturn this;\r\n }\r\n\r\n var eventsKey = '_leaflet_events';\r\n\r\n // @function off(el: HTMLElement, types: String, fn: Function, context?: Object): this\r\n // Removes a previously added listener function.\r\n // Note that if you passed a custom context to on, you must pass the same\r\n // context to `off` in order to remove the listener.\r\n\r\n // @alternative\r\n // @function off(el: HTMLElement, eventMap: Object, context?: Object): this\r\n // Removes a set of type/listener pairs, e.g. `{click: onClick, mousemove: onMouseMove}`\r\n function off(obj, types, fn, context) {\r\n\r\n \tif (typeof types === 'object') {\r\n \t\tfor (var type in types) {\r\n \t\t\tremoveOne(obj, type, types[type], fn);\r\n \t\t}\r\n \t} else if (types) {\r\n \t\ttypes = splitWords(types);\r\n\r\n \t\tfor (var i = 0, len = types.length; i < len; i++) {\r\n \t\t\tremoveOne(obj, types[i], fn, context);\r\n \t\t}\r\n \t} else {\r\n \t\tfor (var j in obj[eventsKey]) {\r\n \t\t\tremoveOne(obj, j, obj[eventsKey][j]);\r\n \t\t}\r\n \t\tdelete obj[eventsKey];\r\n \t}\r\n\r\n \treturn this;\r\n }\r\n\r\n function browserFiresNativeDblClick() {\r\n \t// See https://github.com/w3c/pointerevents/issues/171\r\n \tif (pointer) {\r\n \t\treturn !(edge || safari);\r\n \t}\r\n }\r\n\r\n var mouseSubst = {\r\n \tmouseenter: 'mouseover',\r\n \tmouseleave: 'mouseout',\r\n \twheel: !('onwheel' in window) && 'mousewheel'\r\n };\r\n\r\n function addOne(obj, type, fn, context) {\r\n \tvar id = type + stamp(fn) + (context ? '_' + stamp(context) : '');\r\n\r\n \tif (obj[eventsKey] && obj[eventsKey][id]) { return this; }\r\n\r\n \tvar handler = function (e) {\r\n \t\treturn fn.call(context || obj, e || window.event);\r\n \t};\r\n\r\n \tvar originalHandler = handler;\r\n\r\n \tif (pointer && type.indexOf('touch') === 0) {\r\n \t\t// Needs DomEvent.Pointer.js\r\n \t\taddPointerListener(obj, type, handler, id);\r\n\r\n \t} else if (touch && (type === 'dblclick') && !browserFiresNativeDblClick()) {\r\n \t\taddDoubleTapListener(obj, handler, id);\r\n\r\n \t} else if ('addEventListener' in obj) {\r\n\r\n \t\tif (type === 'touchstart' || type === 'touchmove' || type === 'wheel' || type === 'mousewheel') {\r\n \t\t\tobj.addEventListener(mouseSubst[type] || type, handler, passiveEvents ? {passive: false} : false);\r\n\r\n \t\t} else if (type === 'mouseenter' || type === 'mouseleave') {\r\n \t\t\thandler = function (e) {\r\n \t\t\t\te = e || window.event;\r\n \t\t\t\tif (isExternalTarget(obj, e)) {\r\n \t\t\t\t\toriginalHandler(e);\r\n \t\t\t\t}\r\n \t\t\t};\r\n \t\t\tobj.addEventListener(mouseSubst[type], handler, false);\r\n\r\n \t\t} else {\r\n \t\t\tobj.addEventListener(type, originalHandler, false);\r\n \t\t}\r\n\r\n \t} else if ('attachEvent' in obj) {\r\n \t\tobj.attachEvent('on' + type, handler);\r\n \t}\r\n\r\n \tobj[eventsKey] = obj[eventsKey] || {};\r\n \tobj[eventsKey][id] = handler;\r\n }\r\n\r\n function removeOne(obj, type, fn, context) {\r\n\r\n \tvar id = type + stamp(fn) + (context ? '_' + stamp(context) : ''),\r\n \t handler = obj[eventsKey] && obj[eventsKey][id];\r\n\r\n \tif (!handler) { return this; }\r\n\r\n \tif (pointer && type.indexOf('touch') === 0) {\r\n \t\tremovePointerListener(obj, type, id);\r\n\r\n \t} else if (touch && (type === 'dblclick') && !browserFiresNativeDblClick()) {\r\n \t\tremoveDoubleTapListener(obj, id);\r\n\r\n \t} else if ('removeEventListener' in obj) {\r\n\r\n \t\tobj.removeEventListener(mouseSubst[type] || type, handler, false);\r\n\r\n \t} else if ('detachEvent' in obj) {\r\n \t\tobj.detachEvent('on' + type, handler);\r\n \t}\r\n\r\n \tobj[eventsKey][id] = null;\r\n }\r\n\r\n // @function stopPropagation(ev: DOMEvent): this\r\n // Stop the given event from propagation to parent elements. Used inside the listener functions:\r\n // ```js\r\n // L.DomEvent.on(div, 'click', function (ev) {\r\n // \tL.DomEvent.stopPropagation(ev);\r\n // });\r\n // ```\r\n function stopPropagation(e) {\r\n\r\n \tif (e.stopPropagation) {\r\n \t\te.stopPropagation();\r\n \t} else if (e.originalEvent) { // In case of Leaflet event.\r\n \t\te.originalEvent._stopped = true;\r\n \t} else {\r\n \t\te.cancelBubble = true;\r\n \t}\r\n \tskipped(e);\r\n\r\n \treturn this;\r\n }\r\n\r\n // @function disableScrollPropagation(el: HTMLElement): this\r\n // Adds `stopPropagation` to the element's `'wheel'` events (plus browser variants).\r\n function disableScrollPropagation(el) {\r\n \taddOne(el, 'wheel', stopPropagation);\r\n \treturn this;\r\n }\r\n\r\n // @function disableClickPropagation(el: HTMLElement): this\r\n // Adds `stopPropagation` to the element's `'click'`, `'doubleclick'`,\r\n // `'mousedown'` and `'touchstart'` events (plus browser variants).\r\n function disableClickPropagation(el) {\r\n \ton(el, 'mousedown touchstart dblclick', stopPropagation);\r\n \taddOne(el, 'click', fakeStop);\r\n \treturn this;\r\n }\r\n\r\n // @function preventDefault(ev: DOMEvent): this\r\n // Prevents the default action of the DOM Event `ev` from happening (such as\r\n // following a link in the href of the a element, or doing a POST request\r\n // with page reload when a `
` is submitted).\r\n // Use it inside listener functions.\r\n function preventDefault(e) {\r\n \tif (e.preventDefault) {\r\n \t\te.preventDefault();\r\n \t} else {\r\n \t\te.returnValue = false;\r\n \t}\r\n \treturn this;\r\n }\r\n\r\n // @function stop(ev: DOMEvent): this\r\n // Does `stopPropagation` and `preventDefault` at the same time.\r\n function stop(e) {\r\n \tpreventDefault(e);\r\n \tstopPropagation(e);\r\n \treturn this;\r\n }\r\n\r\n // @function getMousePosition(ev: DOMEvent, container?: HTMLElement): Point\r\n // Gets normalized mouse position from a DOM event relative to the\r\n // `container` (border excluded) or to the whole page if not specified.\r\n function getMousePosition(e, container) {\r\n \tif (!container) {\r\n \t\treturn new Point(e.clientX, e.clientY);\r\n \t}\r\n\r\n \tvar scale = getScale(container),\r\n \t offset = scale.boundingClientRect; // left and top values are in page scale (like the event clientX/Y)\r\n\r\n \treturn new Point(\r\n \t\t// offset.left/top values are in page scale (like clientX/Y),\r\n \t\t// whereas clientLeft/Top (border width) values are the original values (before CSS scale applies).\r\n \t\t(e.clientX - offset.left) / scale.x - container.clientLeft,\r\n \t\t(e.clientY - offset.top) / scale.y - container.clientTop\r\n \t);\r\n }\r\n\r\n // Chrome on Win scrolls double the pixels as in other platforms (see #4538),\r\n // and Firefox scrolls device pixels, not CSS pixels\r\n var wheelPxFactor =\r\n \t(win && chrome) ? 2 * window.devicePixelRatio :\r\n \tgecko ? window.devicePixelRatio : 1;\r\n\r\n // @function getWheelDelta(ev: DOMEvent): Number\r\n // Gets normalized wheel delta from a wheel DOM event, in vertical\r\n // pixels scrolled (negative if scrolling down).\r\n // Events from pointing devices without precise scrolling are mapped to\r\n // a best guess of 60 pixels.\r\n function getWheelDelta(e) {\r\n \treturn (edge) ? e.wheelDeltaY / 2 : // Don't trust window-geometry-based delta\r\n \t (e.deltaY && e.deltaMode === 0) ? -e.deltaY / wheelPxFactor : // Pixels\r\n \t (e.deltaY && e.deltaMode === 1) ? -e.deltaY * 20 : // Lines\r\n \t (e.deltaY && e.deltaMode === 2) ? -e.deltaY * 60 : // Pages\r\n \t (e.deltaX || e.deltaZ) ? 0 :\t// Skip horizontal/depth wheel events\r\n \t e.wheelDelta ? (e.wheelDeltaY || e.wheelDelta) / 2 : // Legacy IE pixels\r\n \t (e.detail && Math.abs(e.detail) < 32765) ? -e.detail * 20 : // Legacy Moz lines\r\n \t e.detail ? e.detail / -32765 * 60 : // Legacy Moz pages\r\n \t 0;\r\n }\r\n\r\n var skipEvents = {};\r\n\r\n function fakeStop(e) {\r\n \t// fakes stopPropagation by setting a special event flag, checked/reset with skipped(e)\r\n \tskipEvents[e.type] = true;\r\n }\r\n\r\n function skipped(e) {\r\n \tvar events = skipEvents[e.type];\r\n \t// reset when checking, as it's only used in map container and propagates outside of the map\r\n \tskipEvents[e.type] = false;\r\n \treturn events;\r\n }\r\n\r\n // check if element really left/entered the event target (for mouseenter/mouseleave)\r\n function isExternalTarget(el, e) {\r\n\r\n \tvar related = e.relatedTarget;\r\n\r\n \tif (!related) { return true; }\r\n\r\n \ttry {\r\n \t\twhile (related && (related !== el)) {\r\n \t\t\trelated = related.parentNode;\r\n \t\t}\r\n \t} catch (err) {\r\n \t\treturn false;\r\n \t}\r\n \treturn (related !== el);\r\n }\n\n var DomEvent = ({\n on: on,\n off: off,\n stopPropagation: stopPropagation,\n disableScrollPropagation: disableScrollPropagation,\n disableClickPropagation: disableClickPropagation,\n preventDefault: preventDefault,\n stop: stop,\n getMousePosition: getMousePosition,\n getWheelDelta: getWheelDelta,\n fakeStop: fakeStop,\n skipped: skipped,\n isExternalTarget: isExternalTarget,\n addListener: on,\n removeListener: off\n });\n\n /*\n * @class PosAnimation\n * @aka L.PosAnimation\n * @inherits Evented\n * Used internally for panning animations, utilizing CSS3 Transitions for modern browsers and a timer fallback for IE6-9.\n *\n * @example\n * ```js\n * var fx = new L.PosAnimation();\n * fx.run(el, [300, 500], 0.5);\n * ```\n *\n * @constructor L.PosAnimation()\n * Creates a `PosAnimation` object.\n *\n */\n\n var PosAnimation = Evented.extend({\n\n \t// @method run(el: HTMLElement, newPos: Point, duration?: Number, easeLinearity?: Number)\n \t// Run an animation of a given element to a new position, optionally setting\n \t// duration in seconds (`0.25` by default) and easing linearity factor (3rd\n \t// argument of the [cubic bezier curve](http://cubic-bezier.com/#0,0,.5,1),\n \t// `0.5` by default).\n \trun: function (el, newPos, duration, easeLinearity) {\n \t\tthis.stop();\n\n \t\tthis._el = el;\n \t\tthis._inProgress = true;\n \t\tthis._duration = duration || 0.25;\n \t\tthis._easeOutPower = 1 / Math.max(easeLinearity || 0.5, 0.2);\n\n \t\tthis._startPos = getPosition(el);\n \t\tthis._offset = newPos.subtract(this._startPos);\n \t\tthis._startTime = +new Date();\n\n \t\t// @event start: Event\n \t\t// Fired when the animation starts\n \t\tthis.fire('start');\n\n \t\tthis._animate();\n \t},\n\n \t// @method stop()\n \t// Stops the animation (if currently running).\n \tstop: function () {\n \t\tif (!this._inProgress) { return; }\n\n \t\tthis._step(true);\n \t\tthis._complete();\n \t},\n\n \t_animate: function () {\n \t\t// animation loop\n \t\tthis._animId = requestAnimFrame(this._animate, this);\n \t\tthis._step();\n \t},\n\n \t_step: function (round) {\n \t\tvar elapsed = (+new Date()) - this._startTime,\n \t\t duration = this._duration * 1000;\n\n \t\tif (elapsed < duration) {\n \t\t\tthis._runFrame(this._easeOut(elapsed / duration), round);\n \t\t} else {\n \t\t\tthis._runFrame(1);\n \t\t\tthis._complete();\n \t\t}\n \t},\n\n \t_runFrame: function (progress, round) {\n \t\tvar pos = this._startPos.add(this._offset.multiplyBy(progress));\n \t\tif (round) {\n \t\t\tpos._round();\n \t\t}\n \t\tsetPosition(this._el, pos);\n\n \t\t// @event step: Event\n \t\t// Fired continuously during the animation.\n \t\tthis.fire('step');\n \t},\n\n \t_complete: function () {\n \t\tcancelAnimFrame(this._animId);\n\n \t\tthis._inProgress = false;\n \t\t// @event end: Event\n \t\t// Fired when the animation ends.\n \t\tthis.fire('end');\n \t},\n\n \t_easeOut: function (t) {\n \t\treturn 1 - Math.pow(1 - t, this._easeOutPower);\n \t}\n });\n\n /*\r\n * @class Map\r\n * @aka L.Map\r\n * @inherits Evented\r\n *\r\n * The central class of the API — it is used to create a map on a page and manipulate it.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * // initialize the map on the \"map\" div with a given center and zoom\r\n * var map = L.map('map', {\r\n * \tcenter: [51.505, -0.09],\r\n * \tzoom: 13\r\n * });\r\n * ```\r\n *\r\n */\r\n\r\n var Map = Evented.extend({\r\n\r\n \toptions: {\r\n \t\t// @section Map State Options\r\n \t\t// @option crs: CRS = L.CRS.EPSG3857\r\n \t\t// The [Coordinate Reference System](#crs) to use. Don't change this if you're not\r\n \t\t// sure what it means.\r\n \t\tcrs: EPSG3857,\r\n\r\n \t\t// @option center: LatLng = undefined\r\n \t\t// Initial geographic center of the map\r\n \t\tcenter: undefined,\r\n\r\n \t\t// @option zoom: Number = undefined\r\n \t\t// Initial map zoom level\r\n \t\tzoom: undefined,\r\n\r\n \t\t// @option minZoom: Number = *\r\n \t\t// Minimum zoom level of the map.\r\n \t\t// If not specified and at least one `GridLayer` or `TileLayer` is in the map,\r\n \t\t// the lowest of their `minZoom` options will be used instead.\r\n \t\tminZoom: undefined,\r\n\r\n \t\t// @option maxZoom: Number = *\r\n \t\t// Maximum zoom level of the map.\r\n \t\t// If not specified and at least one `GridLayer` or `TileLayer` is in the map,\r\n \t\t// the highest of their `maxZoom` options will be used instead.\r\n \t\tmaxZoom: undefined,\r\n\r\n \t\t// @option layers: Layer[] = []\r\n \t\t// Array of layers that will be added to the map initially\r\n \t\tlayers: [],\r\n\r\n \t\t// @option maxBounds: LatLngBounds = null\r\n \t\t// When this option is set, the map restricts the view to the given\r\n \t\t// geographical bounds, bouncing the user back if the user tries to pan\r\n \t\t// outside the view. To set the restriction dynamically, use\r\n \t\t// [`setMaxBounds`](#map-setmaxbounds) method.\r\n \t\tmaxBounds: undefined,\r\n\r\n \t\t// @option renderer: Renderer = *\r\n \t\t// The default method for drawing vector layers on the map. `L.SVG`\r\n \t\t// or `L.Canvas` by default depending on browser support.\r\n \t\trenderer: undefined,\r\n\r\n\r\n \t\t// @section Animation Options\r\n \t\t// @option zoomAnimation: Boolean = true\r\n \t\t// Whether the map zoom animation is enabled. By default it's enabled\r\n \t\t// in all browsers that support CSS3 Transitions except Android.\r\n \t\tzoomAnimation: true,\r\n\r\n \t\t// @option zoomAnimationThreshold: Number = 4\r\n \t\t// Won't animate zoom if the zoom difference exceeds this value.\r\n \t\tzoomAnimationThreshold: 4,\r\n\r\n \t\t// @option fadeAnimation: Boolean = true\r\n \t\t// Whether the tile fade animation is enabled. By default it's enabled\r\n \t\t// in all browsers that support CSS3 Transitions except Android.\r\n \t\tfadeAnimation: true,\r\n\r\n \t\t// @option markerZoomAnimation: Boolean = true\r\n \t\t// Whether markers animate their zoom with the zoom animation, if disabled\r\n \t\t// they will disappear for the length of the animation. By default it's\r\n \t\t// enabled in all browsers that support CSS3 Transitions except Android.\r\n \t\tmarkerZoomAnimation: true,\r\n\r\n \t\t// @option transform3DLimit: Number = 2^23\r\n \t\t// Defines the maximum size of a CSS translation transform. The default\r\n \t\t// value should not be changed unless a web browser positions layers in\r\n \t\t// the wrong place after doing a large `panBy`.\r\n \t\ttransform3DLimit: 8388608, // Precision limit of a 32-bit float\r\n\r\n \t\t// @section Interaction Options\r\n \t\t// @option zoomSnap: Number = 1\r\n \t\t// Forces the map's zoom level to always be a multiple of this, particularly\r\n \t\t// right after a [`fitBounds()`](#map-fitbounds) or a pinch-zoom.\r\n \t\t// By default, the zoom level snaps to the nearest integer; lower values\r\n \t\t// (e.g. `0.5` or `0.1`) allow for greater granularity. A value of `0`\r\n \t\t// means the zoom level will not be snapped after `fitBounds` or a pinch-zoom.\r\n \t\tzoomSnap: 1,\r\n\r\n \t\t// @option zoomDelta: Number = 1\r\n \t\t// Controls how much the map's zoom level will change after a\r\n \t\t// [`zoomIn()`](#map-zoomin), [`zoomOut()`](#map-zoomout), pressing `+`\r\n \t\t// or `-` on the keyboard, or using the [zoom controls](#control-zoom).\r\n \t\t// Values smaller than `1` (e.g. `0.5`) allow for greater granularity.\r\n \t\tzoomDelta: 1,\r\n\r\n \t\t// @option trackResize: Boolean = true\r\n \t\t// Whether the map automatically handles browser window resize to update itself.\r\n \t\ttrackResize: true\r\n \t},\r\n\r\n \tinitialize: function (id, options) { // (HTMLElement or String, Object)\r\n \t\toptions = setOptions(this, options);\r\n\r\n \t\t// Make sure to assign internal flags at the beginning,\r\n \t\t// to avoid inconsistent state in some edge cases.\r\n \t\tthis._handlers = [];\r\n \t\tthis._layers = {};\r\n \t\tthis._zoomBoundLayers = {};\r\n \t\tthis._sizeChanged = true;\r\n\r\n \t\tthis._initContainer(id);\r\n \t\tthis._initLayout();\r\n\r\n \t\t// hack for https://github.com/Leaflet/Leaflet/issues/1980\r\n \t\tthis._onResize = bind(this._onResize, this);\r\n\r\n \t\tthis._initEvents();\r\n\r\n \t\tif (options.maxBounds) {\r\n \t\t\tthis.setMaxBounds(options.maxBounds);\r\n \t\t}\r\n\r\n \t\tif (options.zoom !== undefined) {\r\n \t\t\tthis._zoom = this._limitZoom(options.zoom);\r\n \t\t}\r\n\r\n \t\tif (options.center && options.zoom !== undefined) {\r\n \t\t\tthis.setView(toLatLng(options.center), options.zoom, {reset: true});\r\n \t\t}\r\n\r\n \t\tthis.callInitHooks();\r\n\r\n \t\t// don't animate on browsers without hardware-accelerated transitions or old Android/Opera\r\n \t\tthis._zoomAnimated = TRANSITION && any3d && !mobileOpera &&\r\n \t\t\t\tthis.options.zoomAnimation;\r\n\r\n \t\t// zoom transitions run with the same duration for all layers, so if one of transitionend events\r\n \t\t// happens after starting zoom animation (propagating to the map pane), we know that it ended globally\r\n \t\tif (this._zoomAnimated) {\r\n \t\t\tthis._createAnimProxy();\r\n \t\t\ton(this._proxy, TRANSITION_END, this._catchTransitionEnd, this);\r\n \t\t}\r\n\r\n \t\tthis._addLayers(this.options.layers);\r\n \t},\r\n\r\n\r\n \t// @section Methods for modifying map state\r\n\r\n \t// @method setView(center: LatLng, zoom: Number, options?: Zoom/pan options): this\r\n \t// Sets the view of the map (geographical center and zoom) with the given\r\n \t// animation options.\r\n \tsetView: function (center, zoom, options) {\r\n\r\n \t\tzoom = zoom === undefined ? this._zoom : this._limitZoom(zoom);\r\n \t\tcenter = this._limitCenter(toLatLng(center), zoom, this.options.maxBounds);\r\n \t\toptions = options || {};\r\n\r\n \t\tthis._stop();\r\n\r\n \t\tif (this._loaded && !options.reset && options !== true) {\r\n\r\n \t\t\tif (options.animate !== undefined) {\r\n \t\t\t\toptions.zoom = extend({animate: options.animate}, options.zoom);\r\n \t\t\t\toptions.pan = extend({animate: options.animate, duration: options.duration}, options.pan);\r\n \t\t\t}\r\n\r\n \t\t\t// try animating pan or zoom\r\n \t\t\tvar moved = (this._zoom !== zoom) ?\r\n \t\t\t\tthis._tryAnimatedZoom && this._tryAnimatedZoom(center, zoom, options.zoom) :\r\n \t\t\t\tthis._tryAnimatedPan(center, options.pan);\r\n\r\n \t\t\tif (moved) {\r\n \t\t\t\t// prevent resize handler call, the view will refresh after animation anyway\r\n \t\t\t\tclearTimeout(this._sizeTimer);\r\n \t\t\t\treturn this;\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\t// animation didn't start, just reset the map view\r\n \t\tthis._resetView(center, zoom);\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method setZoom(zoom: Number, options?: Zoom/pan options): this\r\n \t// Sets the zoom of the map.\r\n \tsetZoom: function (zoom, options) {\r\n \t\tif (!this._loaded) {\r\n \t\t\tthis._zoom = zoom;\r\n \t\t\treturn this;\r\n \t\t}\r\n \t\treturn this.setView(this.getCenter(), zoom, {zoom: options});\r\n \t},\r\n\r\n \t// @method zoomIn(delta?: Number, options?: Zoom options): this\r\n \t// Increases the zoom of the map by `delta` ([`zoomDelta`](#map-zoomdelta) by default).\r\n \tzoomIn: function (delta, options) {\r\n \t\tdelta = delta || (any3d ? this.options.zoomDelta : 1);\r\n \t\treturn this.setZoom(this._zoom + delta, options);\r\n \t},\r\n\r\n \t// @method zoomOut(delta?: Number, options?: Zoom options): this\r\n \t// Decreases the zoom of the map by `delta` ([`zoomDelta`](#map-zoomdelta) by default).\r\n \tzoomOut: function (delta, options) {\r\n \t\tdelta = delta || (any3d ? this.options.zoomDelta : 1);\r\n \t\treturn this.setZoom(this._zoom - delta, options);\r\n \t},\r\n\r\n \t// @method setZoomAround(latlng: LatLng, zoom: Number, options: Zoom options): this\r\n \t// Zooms the map while keeping a specified geographical point on the map\r\n \t// stationary (e.g. used internally for scroll zoom and double-click zoom).\r\n \t// @alternative\r\n \t// @method setZoomAround(offset: Point, zoom: Number, options: Zoom options): this\r\n \t// Zooms the map while keeping a specified pixel on the map (relative to the top-left corner) stationary.\r\n \tsetZoomAround: function (latlng, zoom, options) {\r\n \t\tvar scale = this.getZoomScale(zoom),\r\n \t\t viewHalf = this.getSize().divideBy(2),\r\n \t\t containerPoint = latlng instanceof Point ? latlng : this.latLngToContainerPoint(latlng),\r\n\r\n \t\t centerOffset = containerPoint.subtract(viewHalf).multiplyBy(1 - 1 / scale),\r\n \t\t newCenter = this.containerPointToLatLng(viewHalf.add(centerOffset));\r\n\r\n \t\treturn this.setView(newCenter, zoom, {zoom: options});\r\n \t},\r\n\r\n \t_getBoundsCenterZoom: function (bounds, options) {\r\n\r\n \t\toptions = options || {};\r\n \t\tbounds = bounds.getBounds ? bounds.getBounds() : toLatLngBounds(bounds);\r\n\r\n \t\tvar paddingTL = toPoint(options.paddingTopLeft || options.padding || [0, 0]),\r\n \t\t paddingBR = toPoint(options.paddingBottomRight || options.padding || [0, 0]),\r\n\r\n \t\t zoom = this.getBoundsZoom(bounds, false, paddingTL.add(paddingBR));\r\n\r\n \t\tzoom = (typeof options.maxZoom === 'number') ? Math.min(options.maxZoom, zoom) : zoom;\r\n\r\n \t\tif (zoom === Infinity) {\r\n \t\t\treturn {\r\n \t\t\t\tcenter: bounds.getCenter(),\r\n \t\t\t\tzoom: zoom\r\n \t\t\t};\r\n \t\t}\r\n\r\n \t\tvar paddingOffset = paddingBR.subtract(paddingTL).divideBy(2),\r\n\r\n \t\t swPoint = this.project(bounds.getSouthWest(), zoom),\r\n \t\t nePoint = this.project(bounds.getNorthEast(), zoom),\r\n \t\t center = this.unproject(swPoint.add(nePoint).divideBy(2).add(paddingOffset), zoom);\r\n\r\n \t\treturn {\r\n \t\t\tcenter: center,\r\n \t\t\tzoom: zoom\r\n \t\t};\r\n \t},\r\n\r\n \t// @method fitBounds(bounds: LatLngBounds, options?: fitBounds options): this\r\n \t// Sets a map view that contains the given geographical bounds with the\r\n \t// maximum zoom level possible.\r\n \tfitBounds: function (bounds, options) {\r\n\r\n \t\tbounds = toLatLngBounds(bounds);\r\n\r\n \t\tif (!bounds.isValid()) {\r\n \t\t\tthrow new Error('Bounds are not valid.');\r\n \t\t}\r\n\r\n \t\tvar target = this._getBoundsCenterZoom(bounds, options);\r\n \t\treturn this.setView(target.center, target.zoom, options);\r\n \t},\r\n\r\n \t// @method fitWorld(options?: fitBounds options): this\r\n \t// Sets a map view that mostly contains the whole world with the maximum\r\n \t// zoom level possible.\r\n \tfitWorld: function (options) {\r\n \t\treturn this.fitBounds([[-90, -180], [90, 180]], options);\r\n \t},\r\n\r\n \t// @method panTo(latlng: LatLng, options?: Pan options): this\r\n \t// Pans the map to a given center.\r\n \tpanTo: function (center, options) { // (LatLng)\r\n \t\treturn this.setView(center, this._zoom, {pan: options});\r\n \t},\r\n\r\n \t// @method panBy(offset: Point, options?: Pan options): this\r\n \t// Pans the map by a given number of pixels (animated).\r\n \tpanBy: function (offset, options) {\r\n \t\toffset = toPoint(offset).round();\r\n \t\toptions = options || {};\r\n\r\n \t\tif (!offset.x && !offset.y) {\r\n \t\t\treturn this.fire('moveend');\r\n \t\t}\r\n \t\t// If we pan too far, Chrome gets issues with tiles\r\n \t\t// and makes them disappear or appear in the wrong place (slightly offset) #2602\r\n \t\tif (options.animate !== true && !this.getSize().contains(offset)) {\r\n \t\t\tthis._resetView(this.unproject(this.project(this.getCenter()).add(offset)), this.getZoom());\r\n \t\t\treturn this;\r\n \t\t}\r\n\r\n \t\tif (!this._panAnim) {\r\n \t\t\tthis._panAnim = new PosAnimation();\r\n\r\n \t\t\tthis._panAnim.on({\r\n \t\t\t\t'step': this._onPanTransitionStep,\r\n \t\t\t\t'end': this._onPanTransitionEnd\r\n \t\t\t}, this);\r\n \t\t}\r\n\r\n \t\t// don't fire movestart if animating inertia\r\n \t\tif (!options.noMoveStart) {\r\n \t\t\tthis.fire('movestart');\r\n \t\t}\r\n\r\n \t\t// animate pan unless animate: false specified\r\n \t\tif (options.animate !== false) {\r\n \t\t\taddClass(this._mapPane, 'leaflet-pan-anim');\r\n\r\n \t\t\tvar newPos = this._getMapPanePos().subtract(offset).round();\r\n \t\t\tthis._panAnim.run(this._mapPane, newPos, options.duration || 0.25, options.easeLinearity);\r\n \t\t} else {\r\n \t\t\tthis._rawPanBy(offset);\r\n \t\t\tthis.fire('move').fire('moveend');\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method flyTo(latlng: LatLng, zoom?: Number, options?: Zoom/pan options): this\r\n \t// Sets the view of the map (geographical center and zoom) performing a smooth\r\n \t// pan-zoom animation.\r\n \tflyTo: function (targetCenter, targetZoom, options) {\r\n\r\n \t\toptions = options || {};\r\n \t\tif (options.animate === false || !any3d) {\r\n \t\t\treturn this.setView(targetCenter, targetZoom, options);\r\n \t\t}\r\n\r\n \t\tthis._stop();\r\n\r\n \t\tvar from = this.project(this.getCenter()),\r\n \t\t to = this.project(targetCenter),\r\n \t\t size = this.getSize(),\r\n \t\t startZoom = this._zoom;\r\n\r\n \t\ttargetCenter = toLatLng(targetCenter);\r\n \t\ttargetZoom = targetZoom === undefined ? startZoom : targetZoom;\r\n\r\n \t\tvar w0 = Math.max(size.x, size.y),\r\n \t\t w1 = w0 * this.getZoomScale(startZoom, targetZoom),\r\n \t\t u1 = (to.distanceTo(from)) || 1,\r\n \t\t rho = 1.42,\r\n \t\t rho2 = rho * rho;\r\n\r\n \t\tfunction r(i) {\r\n \t\t\tvar s1 = i ? -1 : 1,\r\n \t\t\t s2 = i ? w1 : w0,\r\n \t\t\t t1 = w1 * w1 - w0 * w0 + s1 * rho2 * rho2 * u1 * u1,\r\n \t\t\t b1 = 2 * s2 * rho2 * u1,\r\n \t\t\t b = t1 / b1,\r\n \t\t\t sq = Math.sqrt(b * b + 1) - b;\r\n\r\n \t\t\t // workaround for floating point precision bug when sq = 0, log = -Infinite,\r\n \t\t\t // thus triggering an infinite loop in flyTo\r\n \t\t\t var log = sq < 0.000000001 ? -18 : Math.log(sq);\r\n\r\n \t\t\treturn log;\r\n \t\t}\r\n\r\n \t\tfunction sinh(n) { return (Math.exp(n) - Math.exp(-n)) / 2; }\r\n \t\tfunction cosh(n) { return (Math.exp(n) + Math.exp(-n)) / 2; }\r\n \t\tfunction tanh(n) { return sinh(n) / cosh(n); }\r\n\r\n \t\tvar r0 = r(0);\r\n\r\n \t\tfunction w(s) { return w0 * (cosh(r0) / cosh(r0 + rho * s)); }\r\n \t\tfunction u(s) { return w0 * (cosh(r0) * tanh(r0 + rho * s) - sinh(r0)) / rho2; }\r\n\r\n \t\tfunction easeOut(t) { return 1 - Math.pow(1 - t, 1.5); }\r\n\r\n \t\tvar start = Date.now(),\r\n \t\t S = (r(1) - r0) / rho,\r\n \t\t duration = options.duration ? 1000 * options.duration : 1000 * S * 0.8;\r\n\r\n \t\tfunction frame() {\r\n \t\t\tvar t = (Date.now() - start) / duration,\r\n \t\t\t s = easeOut(t) * S;\r\n\r\n \t\t\tif (t <= 1) {\r\n \t\t\t\tthis._flyToFrame = requestAnimFrame(frame, this);\r\n\r\n \t\t\t\tthis._move(\r\n \t\t\t\t\tthis.unproject(from.add(to.subtract(from).multiplyBy(u(s) / u1)), startZoom),\r\n \t\t\t\t\tthis.getScaleZoom(w0 / w(s), startZoom),\r\n \t\t\t\t\t{flyTo: true});\r\n\r\n \t\t\t} else {\r\n \t\t\t\tthis\r\n \t\t\t\t\t._move(targetCenter, targetZoom)\r\n \t\t\t\t\t._moveEnd(true);\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\tthis._moveStart(true, options.noMoveStart);\r\n\r\n \t\tframe.call(this);\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method flyToBounds(bounds: LatLngBounds, options?: fitBounds options): this\r\n \t// Sets the view of the map with a smooth animation like [`flyTo`](#map-flyto),\r\n \t// but takes a bounds parameter like [`fitBounds`](#map-fitbounds).\r\n \tflyToBounds: function (bounds, options) {\r\n \t\tvar target = this._getBoundsCenterZoom(bounds, options);\r\n \t\treturn this.flyTo(target.center, target.zoom, options);\r\n \t},\r\n\r\n \t// @method setMaxBounds(bounds: LatLngBounds): this\r\n \t// Restricts the map view to the given bounds (see the [maxBounds](#map-maxbounds) option).\r\n \tsetMaxBounds: function (bounds) {\r\n \t\tbounds = toLatLngBounds(bounds);\r\n\r\n \t\tif (!bounds.isValid()) {\r\n \t\t\tthis.options.maxBounds = null;\r\n \t\t\treturn this.off('moveend', this._panInsideMaxBounds);\r\n \t\t} else if (this.options.maxBounds) {\r\n \t\t\tthis.off('moveend', this._panInsideMaxBounds);\r\n \t\t}\r\n\r\n \t\tthis.options.maxBounds = bounds;\r\n\r\n \t\tif (this._loaded) {\r\n \t\t\tthis._panInsideMaxBounds();\r\n \t\t}\r\n\r\n \t\treturn this.on('moveend', this._panInsideMaxBounds);\r\n \t},\r\n\r\n \t// @method setMinZoom(zoom: Number): this\r\n \t// Sets the lower limit for the available zoom levels (see the [minZoom](#map-minzoom) option).\r\n \tsetMinZoom: function (zoom) {\r\n \t\tvar oldZoom = this.options.minZoom;\r\n \t\tthis.options.minZoom = zoom;\r\n\r\n \t\tif (this._loaded && oldZoom !== zoom) {\r\n \t\t\tthis.fire('zoomlevelschange');\r\n\r\n \t\t\tif (this.getZoom() < this.options.minZoom) {\r\n \t\t\t\treturn this.setZoom(zoom);\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method setMaxZoom(zoom: Number): this\r\n \t// Sets the upper limit for the available zoom levels (see the [maxZoom](#map-maxzoom) option).\r\n \tsetMaxZoom: function (zoom) {\r\n \t\tvar oldZoom = this.options.maxZoom;\r\n \t\tthis.options.maxZoom = zoom;\r\n\r\n \t\tif (this._loaded && oldZoom !== zoom) {\r\n \t\t\tthis.fire('zoomlevelschange');\r\n\r\n \t\t\tif (this.getZoom() > this.options.maxZoom) {\r\n \t\t\t\treturn this.setZoom(zoom);\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method panInsideBounds(bounds: LatLngBounds, options?: Pan options): this\r\n \t// Pans the map to the closest view that would lie inside the given bounds (if it's not already), controlling the animation using the options specific, if any.\r\n \tpanInsideBounds: function (bounds, options) {\r\n \t\tthis._enforcingBounds = true;\r\n \t\tvar center = this.getCenter(),\r\n \t\t newCenter = this._limitCenter(center, this._zoom, toLatLngBounds(bounds));\r\n\r\n \t\tif (!center.equals(newCenter)) {\r\n \t\t\tthis.panTo(newCenter, options);\r\n \t\t}\r\n\r\n \t\tthis._enforcingBounds = false;\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method panInside(latlng: LatLng, options?: options): this\r\n \t// Pans the map the minimum amount to make the `latlng` visible. Use\r\n \t// `padding`, `paddingTopLeft` and `paddingTopRight` options to fit\r\n \t// the display to more restricted bounds, like [`fitBounds`](#map-fitbounds).\r\n \t// If `latlng` is already within the (optionally padded) display bounds,\r\n \t// the map will not be panned.\r\n \tpanInside: function (latlng, options) {\r\n \t\toptions = options || {};\r\n\r\n \t\tvar paddingTL = toPoint(options.paddingTopLeft || options.padding || [0, 0]),\r\n \t\t paddingBR = toPoint(options.paddingBottomRight || options.padding || [0, 0]),\r\n \t\t center = this.getCenter(),\r\n \t\t pixelCenter = this.project(center),\r\n \t\t pixelPoint = this.project(latlng),\r\n \t\t pixelBounds = this.getPixelBounds(),\r\n \t\t halfPixelBounds = pixelBounds.getSize().divideBy(2),\r\n \t\t paddedBounds = toBounds([pixelBounds.min.add(paddingTL), pixelBounds.max.subtract(paddingBR)]);\r\n\r\n \t\tif (!paddedBounds.contains(pixelPoint)) {\r\n \t\t\tthis._enforcingBounds = true;\r\n \t\t\tvar diff = pixelCenter.subtract(pixelPoint),\r\n \t\t\t newCenter = toPoint(pixelPoint.x + diff.x, pixelPoint.y + diff.y);\r\n\r\n \t\t\tif (pixelPoint.x < paddedBounds.min.x || pixelPoint.x > paddedBounds.max.x) {\r\n \t\t\t\tnewCenter.x = pixelCenter.x - diff.x;\r\n \t\t\t\tif (diff.x > 0) {\r\n \t\t\t\t\tnewCenter.x += halfPixelBounds.x - paddingTL.x;\r\n \t\t\t\t} else {\r\n \t\t\t\t\tnewCenter.x -= halfPixelBounds.x - paddingBR.x;\r\n \t\t\t\t}\r\n \t\t\t}\r\n \t\t\tif (pixelPoint.y < paddedBounds.min.y || pixelPoint.y > paddedBounds.max.y) {\r\n \t\t\t\tnewCenter.y = pixelCenter.y - diff.y;\r\n \t\t\t\tif (diff.y > 0) {\r\n \t\t\t\t\tnewCenter.y += halfPixelBounds.y - paddingTL.y;\r\n \t\t\t\t} else {\r\n \t\t\t\t\tnewCenter.y -= halfPixelBounds.y - paddingBR.y;\r\n \t\t\t\t}\r\n \t\t\t}\r\n \t\t\tthis.panTo(this.unproject(newCenter), options);\r\n \t\t\tthis._enforcingBounds = false;\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method invalidateSize(options: Zoom/pan options): this\r\n \t// Checks if the map container size changed and updates the map if so —\r\n \t// call it after you've changed the map size dynamically, also animating\r\n \t// pan by default. If `options.pan` is `false`, panning will not occur.\r\n \t// If `options.debounceMoveend` is `true`, it will delay `moveend` event so\r\n \t// that it doesn't happen often even if the method is called many\r\n \t// times in a row.\r\n\r\n \t// @alternative\r\n \t// @method invalidateSize(animate: Boolean): this\r\n \t// Checks if the map container size changed and updates the map if so —\r\n \t// call it after you've changed the map size dynamically, also animating\r\n \t// pan by default.\r\n \tinvalidateSize: function (options) {\r\n \t\tif (!this._loaded) { return this; }\r\n\r\n \t\toptions = extend({\r\n \t\t\tanimate: false,\r\n \t\t\tpan: true\r\n \t\t}, options === true ? {animate: true} : options);\r\n\r\n \t\tvar oldSize = this.getSize();\r\n \t\tthis._sizeChanged = true;\r\n \t\tthis._lastCenter = null;\r\n\r\n \t\tvar newSize = this.getSize(),\r\n \t\t oldCenter = oldSize.divideBy(2).round(),\r\n \t\t newCenter = newSize.divideBy(2).round(),\r\n \t\t offset = oldCenter.subtract(newCenter);\r\n\r\n \t\tif (!offset.x && !offset.y) { return this; }\r\n\r\n \t\tif (options.animate && options.pan) {\r\n \t\t\tthis.panBy(offset);\r\n\r\n \t\t} else {\r\n \t\t\tif (options.pan) {\r\n \t\t\t\tthis._rawPanBy(offset);\r\n \t\t\t}\r\n\r\n \t\t\tthis.fire('move');\r\n\r\n \t\t\tif (options.debounceMoveend) {\r\n \t\t\t\tclearTimeout(this._sizeTimer);\r\n \t\t\t\tthis._sizeTimer = setTimeout(bind(this.fire, this, 'moveend'), 200);\r\n \t\t\t} else {\r\n \t\t\t\tthis.fire('moveend');\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\t// @section Map state change events\r\n \t\t// @event resize: ResizeEvent\r\n \t\t// Fired when the map is resized.\r\n \t\treturn this.fire('resize', {\r\n \t\t\toldSize: oldSize,\r\n \t\t\tnewSize: newSize\r\n \t\t});\r\n \t},\r\n\r\n \t// @section Methods for modifying map state\r\n \t// @method stop(): this\r\n \t// Stops the currently running `panTo` or `flyTo` animation, if any.\r\n \tstop: function () {\r\n \t\tthis.setZoom(this._limitZoom(this._zoom));\r\n \t\tif (!this.options.zoomSnap) {\r\n \t\t\tthis.fire('viewreset');\r\n \t\t}\r\n \t\treturn this._stop();\r\n \t},\r\n\r\n \t// @section Geolocation methods\r\n \t// @method locate(options?: Locate options): this\r\n \t// Tries to locate the user using the Geolocation API, firing a [`locationfound`](#map-locationfound)\r\n \t// event with location data on success or a [`locationerror`](#map-locationerror) event on failure,\r\n \t// and optionally sets the map view to the user's location with respect to\r\n \t// detection accuracy (or to the world view if geolocation failed).\r\n \t// Note that, if your page doesn't use HTTPS, this method will fail in\r\n \t// modern browsers ([Chrome 50 and newer](https://sites.google.com/a/chromium.org/dev/Home/chromium-security/deprecating-powerful-features-on-insecure-origins))\r\n \t// See `Locate options` for more details.\r\n \tlocate: function (options) {\r\n\r\n \t\toptions = this._locateOptions = extend({\r\n \t\t\ttimeout: 10000,\r\n \t\t\twatch: false\r\n \t\t\t// setView: false\r\n \t\t\t// maxZoom: \r\n \t\t\t// maximumAge: 0\r\n \t\t\t// enableHighAccuracy: false\r\n \t\t}, options);\r\n\r\n \t\tif (!('geolocation' in navigator)) {\r\n \t\t\tthis._handleGeolocationError({\r\n \t\t\t\tcode: 0,\r\n \t\t\t\tmessage: 'Geolocation not supported.'\r\n \t\t\t});\r\n \t\t\treturn this;\r\n \t\t}\r\n\r\n \t\tvar onResponse = bind(this._handleGeolocationResponse, this),\r\n \t\t onError = bind(this._handleGeolocationError, this);\r\n\r\n \t\tif (options.watch) {\r\n \t\t\tthis._locationWatchId =\r\n \t\t\t navigator.geolocation.watchPosition(onResponse, onError, options);\r\n \t\t} else {\r\n \t\t\tnavigator.geolocation.getCurrentPosition(onResponse, onError, options);\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method stopLocate(): this\r\n \t// Stops watching location previously initiated by `map.locate({watch: true})`\r\n \t// and aborts resetting the map view if map.locate was called with\r\n \t// `{setView: true}`.\r\n \tstopLocate: function () {\r\n \t\tif (navigator.geolocation && navigator.geolocation.clearWatch) {\r\n \t\t\tnavigator.geolocation.clearWatch(this._locationWatchId);\r\n \t\t}\r\n \t\tif (this._locateOptions) {\r\n \t\t\tthis._locateOptions.setView = false;\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \t_handleGeolocationError: function (error) {\r\n \t\tvar c = error.code,\r\n \t\t message = error.message ||\r\n \t\t (c === 1 ? 'permission denied' :\r\n \t\t (c === 2 ? 'position unavailable' : 'timeout'));\r\n\r\n \t\tif (this._locateOptions.setView && !this._loaded) {\r\n \t\t\tthis.fitWorld();\r\n \t\t}\r\n\r\n \t\t// @section Location events\r\n \t\t// @event locationerror: ErrorEvent\r\n \t\t// Fired when geolocation (using the [`locate`](#map-locate) method) failed.\r\n \t\tthis.fire('locationerror', {\r\n \t\t\tcode: c,\r\n \t\t\tmessage: 'Geolocation error: ' + message + '.'\r\n \t\t});\r\n \t},\r\n\r\n \t_handleGeolocationResponse: function (pos) {\r\n \t\tvar lat = pos.coords.latitude,\r\n \t\t lng = pos.coords.longitude,\r\n \t\t latlng = new LatLng(lat, lng),\r\n \t\t bounds = latlng.toBounds(pos.coords.accuracy * 2),\r\n \t\t options = this._locateOptions;\r\n\r\n \t\tif (options.setView) {\r\n \t\t\tvar zoom = this.getBoundsZoom(bounds);\r\n \t\t\tthis.setView(latlng, options.maxZoom ? Math.min(zoom, options.maxZoom) : zoom);\r\n \t\t}\r\n\r\n \t\tvar data = {\r\n \t\t\tlatlng: latlng,\r\n \t\t\tbounds: bounds,\r\n \t\t\ttimestamp: pos.timestamp\r\n \t\t};\r\n\r\n \t\tfor (var i in pos.coords) {\r\n \t\t\tif (typeof pos.coords[i] === 'number') {\r\n \t\t\t\tdata[i] = pos.coords[i];\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\t// @event locationfound: LocationEvent\r\n \t\t// Fired when geolocation (using the [`locate`](#map-locate) method)\r\n \t\t// went successfully.\r\n \t\tthis.fire('locationfound', data);\r\n \t},\r\n\r\n \t// TODO Appropriate docs section?\r\n \t// @section Other Methods\r\n \t// @method addHandler(name: String, HandlerClass: Function): this\r\n \t// Adds a new `Handler` to the map, given its name and constructor function.\r\n \taddHandler: function (name, HandlerClass) {\r\n \t\tif (!HandlerClass) { return this; }\r\n\r\n \t\tvar handler = this[name] = new HandlerClass(this);\r\n\r\n \t\tthis._handlers.push(handler);\r\n\r\n \t\tif (this.options[name]) {\r\n \t\t\thandler.enable();\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method remove(): this\r\n \t// Destroys the map and clears all related event listeners.\r\n \tremove: function () {\r\n\r\n \t\tthis._initEvents(true);\r\n \t\tthis.off('moveend', this._panInsideMaxBounds);\r\n\r\n \t\tif (this._containerId !== this._container._leaflet_id) {\r\n \t\t\tthrow new Error('Map container is being reused by another instance');\r\n \t\t}\r\n\r\n \t\ttry {\r\n \t\t\t// throws error in IE6-8\r\n \t\t\tdelete this._container._leaflet_id;\r\n \t\t\tdelete this._containerId;\r\n \t\t} catch (e) {\r\n \t\t\t/*eslint-disable */\r\n \t\t\tthis._container._leaflet_id = undefined;\r\n \t\t\t/* eslint-enable */\r\n \t\t\tthis._containerId = undefined;\r\n \t\t}\r\n\r\n \t\tif (this._locationWatchId !== undefined) {\r\n \t\t\tthis.stopLocate();\r\n \t\t}\r\n\r\n \t\tthis._stop();\r\n\r\n \t\tremove(this._mapPane);\r\n\r\n \t\tif (this._clearControlPos) {\r\n \t\t\tthis._clearControlPos();\r\n \t\t}\r\n \t\tif (this._resizeRequest) {\r\n \t\t\tcancelAnimFrame(this._resizeRequest);\r\n \t\t\tthis._resizeRequest = null;\r\n \t\t}\r\n\r\n \t\tthis._clearHandlers();\r\n\r\n \t\tif (this._loaded) {\r\n \t\t\t// @section Map state change events\r\n \t\t\t// @event unload: Event\r\n \t\t\t// Fired when the map is destroyed with [remove](#map-remove) method.\r\n \t\t\tthis.fire('unload');\r\n \t\t}\r\n\r\n \t\tvar i;\r\n \t\tfor (i in this._layers) {\r\n \t\t\tthis._layers[i].remove();\r\n \t\t}\r\n \t\tfor (i in this._panes) {\r\n \t\t\tremove(this._panes[i]);\r\n \t\t}\r\n\r\n \t\tthis._layers = [];\r\n \t\tthis._panes = [];\r\n \t\tdelete this._mapPane;\r\n \t\tdelete this._renderer;\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @section Other Methods\r\n \t// @method createPane(name: String, container?: HTMLElement): HTMLElement\r\n \t// Creates a new [map pane](#map-pane) with the given name if it doesn't exist already,\r\n \t// then returns it. The pane is created as a child of `container`, or\r\n \t// as a child of the main map pane if not set.\r\n \tcreatePane: function (name, container) {\r\n \t\tvar className = 'leaflet-pane' + (name ? ' leaflet-' + name.replace('Pane', '') + '-pane' : ''),\r\n \t\t pane = create$1('div', className, container || this._mapPane);\r\n\r\n \t\tif (name) {\r\n \t\t\tthis._panes[name] = pane;\r\n \t\t}\r\n \t\treturn pane;\r\n \t},\r\n\r\n \t// @section Methods for Getting Map State\r\n\r\n \t// @method getCenter(): LatLng\r\n \t// Returns the geographical center of the map view\r\n \tgetCenter: function () {\r\n \t\tthis._checkIfLoaded();\r\n\r\n \t\tif (this._lastCenter && !this._moved()) {\r\n \t\t\treturn this._lastCenter;\r\n \t\t}\r\n \t\treturn this.layerPointToLatLng(this._getCenterLayerPoint());\r\n \t},\r\n\r\n \t// @method getZoom(): Number\r\n \t// Returns the current zoom level of the map view\r\n \tgetZoom: function () {\r\n \t\treturn this._zoom;\r\n \t},\r\n\r\n \t// @method getBounds(): LatLngBounds\r\n \t// Returns the geographical bounds visible in the current map view\r\n \tgetBounds: function () {\r\n \t\tvar bounds = this.getPixelBounds(),\r\n \t\t sw = this.unproject(bounds.getBottomLeft()),\r\n \t\t ne = this.unproject(bounds.getTopRight());\r\n\r\n \t\treturn new LatLngBounds(sw, ne);\r\n \t},\r\n\r\n \t// @method getMinZoom(): Number\r\n \t// Returns the minimum zoom level of the map (if set in the `minZoom` option of the map or of any layers), or `0` by default.\r\n \tgetMinZoom: function () {\r\n \t\treturn this.options.minZoom === undefined ? this._layersMinZoom || 0 : this.options.minZoom;\r\n \t},\r\n\r\n \t// @method getMaxZoom(): Number\r\n \t// Returns the maximum zoom level of the map (if set in the `maxZoom` option of the map or of any layers).\r\n \tgetMaxZoom: function () {\r\n \t\treturn this.options.maxZoom === undefined ?\r\n \t\t\t(this._layersMaxZoom === undefined ? Infinity : this._layersMaxZoom) :\r\n \t\t\tthis.options.maxZoom;\r\n \t},\r\n\r\n \t// @method getBoundsZoom(bounds: LatLngBounds, inside?: Boolean, padding?: Point): Number\r\n \t// Returns the maximum zoom level on which the given bounds fit to the map\r\n \t// view in its entirety. If `inside` (optional) is set to `true`, the method\r\n \t// instead returns the minimum zoom level on which the map view fits into\r\n \t// the given bounds in its entirety.\r\n \tgetBoundsZoom: function (bounds, inside, padding) { // (LatLngBounds[, Boolean, Point]) -> Number\r\n \t\tbounds = toLatLngBounds(bounds);\r\n \t\tpadding = toPoint(padding || [0, 0]);\r\n\r\n \t\tvar zoom = this.getZoom() || 0,\r\n \t\t min = this.getMinZoom(),\r\n \t\t max = this.getMaxZoom(),\r\n \t\t nw = bounds.getNorthWest(),\r\n \t\t se = bounds.getSouthEast(),\r\n \t\t size = this.getSize().subtract(padding),\r\n \t\t boundsSize = toBounds(this.project(se, zoom), this.project(nw, zoom)).getSize(),\r\n \t\t snap = any3d ? this.options.zoomSnap : 1,\r\n \t\t scalex = size.x / boundsSize.x,\r\n \t\t scaley = size.y / boundsSize.y,\r\n \t\t scale = inside ? Math.max(scalex, scaley) : Math.min(scalex, scaley);\r\n\r\n \t\tzoom = this.getScaleZoom(scale, zoom);\r\n\r\n \t\tif (snap) {\r\n \t\t\tzoom = Math.round(zoom / (snap / 100)) * (snap / 100); // don't jump if within 1% of a snap level\r\n \t\t\tzoom = inside ? Math.ceil(zoom / snap) * snap : Math.floor(zoom / snap) * snap;\r\n \t\t}\r\n\r\n \t\treturn Math.max(min, Math.min(max, zoom));\r\n \t},\r\n\r\n \t// @method getSize(): Point\r\n \t// Returns the current size of the map container (in pixels).\r\n \tgetSize: function () {\r\n \t\tif (!this._size || this._sizeChanged) {\r\n \t\t\tthis._size = new Point(\r\n \t\t\t\tthis._container.clientWidth || 0,\r\n \t\t\t\tthis._container.clientHeight || 0);\r\n\r\n \t\t\tthis._sizeChanged = false;\r\n \t\t}\r\n \t\treturn this._size.clone();\r\n \t},\r\n\r\n \t// @method getPixelBounds(): Bounds\r\n \t// Returns the bounds of the current map view in projected pixel\r\n \t// coordinates (sometimes useful in layer and overlay implementations).\r\n \tgetPixelBounds: function (center, zoom) {\r\n \t\tvar topLeftPoint = this._getTopLeftPoint(center, zoom);\r\n \t\treturn new Bounds(topLeftPoint, topLeftPoint.add(this.getSize()));\r\n \t},\r\n\r\n \t// TODO: Check semantics - isn't the pixel origin the 0,0 coord relative to\r\n \t// the map pane? \"left point of the map layer\" can be confusing, specially\r\n \t// since there can be negative offsets.\r\n \t// @method getPixelOrigin(): Point\r\n \t// Returns the projected pixel coordinates of the top left point of\r\n \t// the map layer (useful in custom layer and overlay implementations).\r\n \tgetPixelOrigin: function () {\r\n \t\tthis._checkIfLoaded();\r\n \t\treturn this._pixelOrigin;\r\n \t},\r\n\r\n \t// @method getPixelWorldBounds(zoom?: Number): Bounds\r\n \t// Returns the world's bounds in pixel coordinates for zoom level `zoom`.\r\n \t// If `zoom` is omitted, the map's current zoom level is used.\r\n \tgetPixelWorldBounds: function (zoom) {\r\n \t\treturn this.options.crs.getProjectedBounds(zoom === undefined ? this.getZoom() : zoom);\r\n \t},\r\n\r\n \t// @section Other Methods\r\n\r\n \t// @method getPane(pane: String|HTMLElement): HTMLElement\r\n \t// Returns a [map pane](#map-pane), given its name or its HTML element (its identity).\r\n \tgetPane: function (pane) {\r\n \t\treturn typeof pane === 'string' ? this._panes[pane] : pane;\r\n \t},\r\n\r\n \t// @method getPanes(): Object\r\n \t// Returns a plain object containing the names of all [panes](#map-pane) as keys and\r\n \t// the panes as values.\r\n \tgetPanes: function () {\r\n \t\treturn this._panes;\r\n \t},\r\n\r\n \t// @method getContainer: HTMLElement\r\n \t// Returns the HTML element that contains the map.\r\n \tgetContainer: function () {\r\n \t\treturn this._container;\r\n \t},\r\n\r\n\r\n \t// @section Conversion Methods\r\n\r\n \t// @method getZoomScale(toZoom: Number, fromZoom: Number): Number\r\n \t// Returns the scale factor to be applied to a map transition from zoom level\r\n \t// `fromZoom` to `toZoom`. Used internally to help with zoom animations.\r\n \tgetZoomScale: function (toZoom, fromZoom) {\r\n \t\t// TODO replace with universal implementation after refactoring projections\r\n \t\tvar crs = this.options.crs;\r\n \t\tfromZoom = fromZoom === undefined ? this._zoom : fromZoom;\r\n \t\treturn crs.scale(toZoom) / crs.scale(fromZoom);\r\n \t},\r\n\r\n \t// @method getScaleZoom(scale: Number, fromZoom: Number): Number\r\n \t// Returns the zoom level that the map would end up at, if it is at `fromZoom`\r\n \t// level and everything is scaled by a factor of `scale`. Inverse of\r\n \t// [`getZoomScale`](#map-getZoomScale).\r\n \tgetScaleZoom: function (scale, fromZoom) {\r\n \t\tvar crs = this.options.crs;\r\n \t\tfromZoom = fromZoom === undefined ? this._zoom : fromZoom;\r\n \t\tvar zoom = crs.zoom(scale * crs.scale(fromZoom));\r\n \t\treturn isNaN(zoom) ? Infinity : zoom;\r\n \t},\r\n\r\n \t// @method project(latlng: LatLng, zoom: Number): Point\r\n \t// Projects a geographical coordinate `LatLng` according to the projection\r\n \t// of the map's CRS, then scales it according to `zoom` and the CRS's\r\n \t// `Transformation`. The result is pixel coordinate relative to\r\n \t// the CRS origin.\r\n \tproject: function (latlng, zoom) {\r\n \t\tzoom = zoom === undefined ? this._zoom : zoom;\r\n \t\treturn this.options.crs.latLngToPoint(toLatLng(latlng), zoom);\r\n \t},\r\n\r\n \t// @method unproject(point: Point, zoom: Number): LatLng\r\n \t// Inverse of [`project`](#map-project).\r\n \tunproject: function (point, zoom) {\r\n \t\tzoom = zoom === undefined ? this._zoom : zoom;\r\n \t\treturn this.options.crs.pointToLatLng(toPoint(point), zoom);\r\n \t},\r\n\r\n \t// @method layerPointToLatLng(point: Point): LatLng\r\n \t// Given a pixel coordinate relative to the [origin pixel](#map-getpixelorigin),\r\n \t// returns the corresponding geographical coordinate (for the current zoom level).\r\n \tlayerPointToLatLng: function (point) {\r\n \t\tvar projectedPoint = toPoint(point).add(this.getPixelOrigin());\r\n \t\treturn this.unproject(projectedPoint);\r\n \t},\r\n\r\n \t// @method latLngToLayerPoint(latlng: LatLng): Point\r\n \t// Given a geographical coordinate, returns the corresponding pixel coordinate\r\n \t// relative to the [origin pixel](#map-getpixelorigin).\r\n \tlatLngToLayerPoint: function (latlng) {\r\n \t\tvar projectedPoint = this.project(toLatLng(latlng))._round();\r\n \t\treturn projectedPoint._subtract(this.getPixelOrigin());\r\n \t},\r\n\r\n \t// @method wrapLatLng(latlng: LatLng): LatLng\r\n \t// Returns a `LatLng` where `lat` and `lng` has been wrapped according to the\r\n \t// map's CRS's `wrapLat` and `wrapLng` properties, if they are outside the\r\n \t// CRS's bounds.\r\n \t// By default this means longitude is wrapped around the dateline so its\r\n \t// value is between -180 and +180 degrees.\r\n \twrapLatLng: function (latlng) {\r\n \t\treturn this.options.crs.wrapLatLng(toLatLng(latlng));\r\n \t},\r\n\r\n \t// @method wrapLatLngBounds(bounds: LatLngBounds): LatLngBounds\r\n \t// Returns a `LatLngBounds` with the same size as the given one, ensuring that\r\n \t// its center is within the CRS's bounds.\r\n \t// By default this means the center longitude is wrapped around the dateline so its\r\n \t// value is between -180 and +180 degrees, and the majority of the bounds\r\n \t// overlaps the CRS's bounds.\r\n \twrapLatLngBounds: function (latlng) {\r\n \t\treturn this.options.crs.wrapLatLngBounds(toLatLngBounds(latlng));\r\n \t},\r\n\r\n \t// @method distance(latlng1: LatLng, latlng2: LatLng): Number\r\n \t// Returns the distance between two geographical coordinates according to\r\n \t// the map's CRS. By default this measures distance in meters.\r\n \tdistance: function (latlng1, latlng2) {\r\n \t\treturn this.options.crs.distance(toLatLng(latlng1), toLatLng(latlng2));\r\n \t},\r\n\r\n \t// @method containerPointToLayerPoint(point: Point): Point\r\n \t// Given a pixel coordinate relative to the map container, returns the corresponding\r\n \t// pixel coordinate relative to the [origin pixel](#map-getpixelorigin).\r\n \tcontainerPointToLayerPoint: function (point) { // (Point)\r\n \t\treturn toPoint(point).subtract(this._getMapPanePos());\r\n \t},\r\n\r\n \t// @method layerPointToContainerPoint(point: Point): Point\r\n \t// Given a pixel coordinate relative to the [origin pixel](#map-getpixelorigin),\r\n \t// returns the corresponding pixel coordinate relative to the map container.\r\n \tlayerPointToContainerPoint: function (point) { // (Point)\r\n \t\treturn toPoint(point).add(this._getMapPanePos());\r\n \t},\r\n\r\n \t// @method containerPointToLatLng(point: Point): LatLng\r\n \t// Given a pixel coordinate relative to the map container, returns\r\n \t// the corresponding geographical coordinate (for the current zoom level).\r\n \tcontainerPointToLatLng: function (point) {\r\n \t\tvar layerPoint = this.containerPointToLayerPoint(toPoint(point));\r\n \t\treturn this.layerPointToLatLng(layerPoint);\r\n \t},\r\n\r\n \t// @method latLngToContainerPoint(latlng: LatLng): Point\r\n \t// Given a geographical coordinate, returns the corresponding pixel coordinate\r\n \t// relative to the map container.\r\n \tlatLngToContainerPoint: function (latlng) {\r\n \t\treturn this.layerPointToContainerPoint(this.latLngToLayerPoint(toLatLng(latlng)));\r\n \t},\r\n\r\n \t// @method mouseEventToContainerPoint(ev: MouseEvent): Point\r\n \t// Given a MouseEvent object, returns the pixel coordinate relative to the\r\n \t// map container where the event took place.\r\n \tmouseEventToContainerPoint: function (e) {\r\n \t\treturn getMousePosition(e, this._container);\r\n \t},\r\n\r\n \t// @method mouseEventToLayerPoint(ev: MouseEvent): Point\r\n \t// Given a MouseEvent object, returns the pixel coordinate relative to\r\n \t// the [origin pixel](#map-getpixelorigin) where the event took place.\r\n \tmouseEventToLayerPoint: function (e) {\r\n \t\treturn this.containerPointToLayerPoint(this.mouseEventToContainerPoint(e));\r\n \t},\r\n\r\n \t// @method mouseEventToLatLng(ev: MouseEvent): LatLng\r\n \t// Given a MouseEvent object, returns geographical coordinate where the\r\n \t// event took place.\r\n \tmouseEventToLatLng: function (e) { // (MouseEvent)\r\n \t\treturn this.layerPointToLatLng(this.mouseEventToLayerPoint(e));\r\n \t},\r\n\r\n\r\n \t// map initialization methods\r\n\r\n \t_initContainer: function (id) {\r\n \t\tvar container = this._container = get(id);\r\n\r\n \t\tif (!container) {\r\n \t\t\tthrow new Error('Map container not found.');\r\n \t\t} else if (container._leaflet_id) {\r\n \t\t\tthrow new Error('Map container is already initialized.');\r\n \t\t}\r\n\r\n \t\ton(container, 'scroll', this._onScroll, this);\r\n \t\tthis._containerId = stamp(container);\r\n \t},\r\n\r\n \t_initLayout: function () {\r\n \t\tvar container = this._container;\r\n\r\n \t\tthis._fadeAnimated = this.options.fadeAnimation && any3d;\r\n\r\n \t\taddClass(container, 'leaflet-container' +\r\n \t\t\t(touch ? ' leaflet-touch' : '') +\r\n \t\t\t(retina ? ' leaflet-retina' : '') +\r\n \t\t\t(ielt9 ? ' leaflet-oldie' : '') +\r\n \t\t\t(safari ? ' leaflet-safari' : '') +\r\n \t\t\t(this._fadeAnimated ? ' leaflet-fade-anim' : ''));\r\n\r\n \t\tvar position = getStyle(container, 'position');\r\n\r\n \t\tif (position !== 'absolute' && position !== 'relative' && position !== 'fixed') {\r\n \t\t\tcontainer.style.position = 'relative';\r\n \t\t}\r\n\r\n \t\tthis._initPanes();\r\n\r\n \t\tif (this._initControlPos) {\r\n \t\t\tthis._initControlPos();\r\n \t\t}\r\n \t},\r\n\r\n \t_initPanes: function () {\r\n \t\tvar panes = this._panes = {};\r\n \t\tthis._paneRenderers = {};\r\n\r\n \t\t// @section\r\n \t\t//\r\n \t\t// Panes are DOM elements used to control the ordering of layers on the map. You\r\n \t\t// can access panes with [`map.getPane`](#map-getpane) or\r\n \t\t// [`map.getPanes`](#map-getpanes) methods. New panes can be created with the\r\n \t\t// [`map.createPane`](#map-createpane) method.\r\n \t\t//\r\n \t\t// Every map has the following default panes that differ only in zIndex.\r\n \t\t//\r\n \t\t// @pane mapPane: HTMLElement = 'auto'\r\n \t\t// Pane that contains all other map panes\r\n\r\n \t\tthis._mapPane = this.createPane('mapPane', this._container);\r\n \t\tsetPosition(this._mapPane, new Point(0, 0));\r\n\r\n \t\t// @pane tilePane: HTMLElement = 200\r\n \t\t// Pane for `GridLayer`s and `TileLayer`s\r\n \t\tthis.createPane('tilePane');\r\n \t\t// @pane overlayPane: HTMLElement = 400\r\n \t\t// Pane for overlay shadows (e.g. `Marker` shadows)\r\n \t\tthis.createPane('shadowPane');\r\n \t\t// @pane shadowPane: HTMLElement = 500\r\n \t\t// Pane for vectors (`Path`s, like `Polyline`s and `Polygon`s), `ImageOverlay`s and `VideoOverlay`s\r\n \t\tthis.createPane('overlayPane');\r\n \t\t// @pane markerPane: HTMLElement = 600\r\n \t\t// Pane for `Icon`s of `Marker`s\r\n \t\tthis.createPane('markerPane');\r\n \t\t// @pane tooltipPane: HTMLElement = 650\r\n \t\t// Pane for `Tooltip`s.\r\n \t\tthis.createPane('tooltipPane');\r\n \t\t// @pane popupPane: HTMLElement = 700\r\n \t\t// Pane for `Popup`s.\r\n \t\tthis.createPane('popupPane');\r\n\r\n \t\tif (!this.options.markerZoomAnimation) {\r\n \t\t\taddClass(panes.markerPane, 'leaflet-zoom-hide');\r\n \t\t\taddClass(panes.shadowPane, 'leaflet-zoom-hide');\r\n \t\t}\r\n \t},\r\n\r\n\r\n \t// private methods that modify map state\r\n\r\n \t// @section Map state change events\r\n \t_resetView: function (center, zoom) {\r\n \t\tsetPosition(this._mapPane, new Point(0, 0));\r\n\r\n \t\tvar loading = !this._loaded;\r\n \t\tthis._loaded = true;\r\n \t\tzoom = this._limitZoom(zoom);\r\n\r\n \t\tthis.fire('viewprereset');\r\n\r\n \t\tvar zoomChanged = this._zoom !== zoom;\r\n \t\tthis\r\n \t\t\t._moveStart(zoomChanged, false)\r\n \t\t\t._move(center, zoom)\r\n \t\t\t._moveEnd(zoomChanged);\r\n\r\n \t\t// @event viewreset: Event\r\n \t\t// Fired when the map needs to redraw its content (this usually happens\r\n \t\t// on map zoom or load). Very useful for creating custom overlays.\r\n \t\tthis.fire('viewreset');\r\n\r\n \t\t// @event load: Event\r\n \t\t// Fired when the map is initialized (when its center and zoom are set\r\n \t\t// for the first time).\r\n \t\tif (loading) {\r\n \t\t\tthis.fire('load');\r\n \t\t}\r\n \t},\r\n\r\n \t_moveStart: function (zoomChanged, noMoveStart) {\r\n \t\t// @event zoomstart: Event\r\n \t\t// Fired when the map zoom is about to change (e.g. before zoom animation).\r\n \t\t// @event movestart: Event\r\n \t\t// Fired when the view of the map starts changing (e.g. user starts dragging the map).\r\n \t\tif (zoomChanged) {\r\n \t\t\tthis.fire('zoomstart');\r\n \t\t}\r\n \t\tif (!noMoveStart) {\r\n \t\t\tthis.fire('movestart');\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \t_move: function (center, zoom, data) {\r\n \t\tif (zoom === undefined) {\r\n \t\t\tzoom = this._zoom;\r\n \t\t}\r\n \t\tvar zoomChanged = this._zoom !== zoom;\r\n\r\n \t\tthis._zoom = zoom;\r\n \t\tthis._lastCenter = center;\r\n \t\tthis._pixelOrigin = this._getNewPixelOrigin(center);\r\n\r\n \t\t// @event zoom: Event\r\n \t\t// Fired repeatedly during any change in zoom level, including zoom\r\n \t\t// and fly animations.\r\n \t\tif (zoomChanged || (data && data.pinch)) {\t// Always fire 'zoom' if pinching because #3530\r\n \t\t\tthis.fire('zoom', data);\r\n \t\t}\r\n\r\n \t\t// @event move: Event\r\n \t\t// Fired repeatedly during any movement of the map, including pan and\r\n \t\t// fly animations.\r\n \t\treturn this.fire('move', data);\r\n \t},\r\n\r\n \t_moveEnd: function (zoomChanged) {\r\n \t\t// @event zoomend: Event\r\n \t\t// Fired when the map has changed, after any animations.\r\n \t\tif (zoomChanged) {\r\n \t\t\tthis.fire('zoomend');\r\n \t\t}\r\n\r\n \t\t// @event moveend: Event\r\n \t\t// Fired when the center of the map stops changing (e.g. user stopped\r\n \t\t// dragging the map).\r\n \t\treturn this.fire('moveend');\r\n \t},\r\n\r\n \t_stop: function () {\r\n \t\tcancelAnimFrame(this._flyToFrame);\r\n \t\tif (this._panAnim) {\r\n \t\t\tthis._panAnim.stop();\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \t_rawPanBy: function (offset) {\r\n \t\tsetPosition(this._mapPane, this._getMapPanePos().subtract(offset));\r\n \t},\r\n\r\n \t_getZoomSpan: function () {\r\n \t\treturn this.getMaxZoom() - this.getMinZoom();\r\n \t},\r\n\r\n \t_panInsideMaxBounds: function () {\r\n \t\tif (!this._enforcingBounds) {\r\n \t\t\tthis.panInsideBounds(this.options.maxBounds);\r\n \t\t}\r\n \t},\r\n\r\n \t_checkIfLoaded: function () {\r\n \t\tif (!this._loaded) {\r\n \t\t\tthrow new Error('Set map center and zoom first.');\r\n \t\t}\r\n \t},\r\n\r\n \t// DOM event handling\r\n\r\n \t// @section Interaction events\r\n \t_initEvents: function (remove$$1) {\r\n \t\tthis._targets = {};\r\n \t\tthis._targets[stamp(this._container)] = this;\r\n\r\n \t\tvar onOff = remove$$1 ? off : on;\r\n\r\n \t\t// @event click: MouseEvent\r\n \t\t// Fired when the user clicks (or taps) the map.\r\n \t\t// @event dblclick: MouseEvent\r\n \t\t// Fired when the user double-clicks (or double-taps) the map.\r\n \t\t// @event mousedown: MouseEvent\r\n \t\t// Fired when the user pushes the mouse button on the map.\r\n \t\t// @event mouseup: MouseEvent\r\n \t\t// Fired when the user releases the mouse button on the map.\r\n \t\t// @event mouseover: MouseEvent\r\n \t\t// Fired when the mouse enters the map.\r\n \t\t// @event mouseout: MouseEvent\r\n \t\t// Fired when the mouse leaves the map.\r\n \t\t// @event mousemove: MouseEvent\r\n \t\t// Fired while the mouse moves over the map.\r\n \t\t// @event contextmenu: MouseEvent\r\n \t\t// Fired when the user pushes the right mouse button on the map, prevents\r\n \t\t// default browser context menu from showing if there are listeners on\r\n \t\t// this event. Also fired on mobile when the user holds a single touch\r\n \t\t// for a second (also called long press).\r\n \t\t// @event keypress: KeyboardEvent\r\n \t\t// Fired when the user presses a key from the keyboard that produces a character value while the map is focused.\r\n \t\t// @event keydown: KeyboardEvent\r\n \t\t// Fired when the user presses a key from the keyboard while the map is focused. Unlike the `keypress` event,\r\n \t\t// the `keydown` event is fired for keys that produce a character value and for keys\r\n \t\t// that do not produce a character value.\r\n \t\t// @event keyup: KeyboardEvent\r\n \t\t// Fired when the user releases a key from the keyboard while the map is focused.\r\n \t\tonOff(this._container, 'click dblclick mousedown mouseup ' +\r\n \t\t\t'mouseover mouseout mousemove contextmenu keypress keydown keyup', this._handleDOMEvent, this);\r\n\r\n \t\tif (this.options.trackResize) {\r\n \t\t\tonOff(window, 'resize', this._onResize, this);\r\n \t\t}\r\n\r\n \t\tif (any3d && this.options.transform3DLimit) {\r\n \t\t\t(remove$$1 ? this.off : this.on).call(this, 'moveend', this._onMoveEnd);\r\n \t\t}\r\n \t},\r\n\r\n \t_onResize: function () {\r\n \t\tcancelAnimFrame(this._resizeRequest);\r\n \t\tthis._resizeRequest = requestAnimFrame(\r\n \t\t function () { this.invalidateSize({debounceMoveend: true}); }, this);\r\n \t},\r\n\r\n \t_onScroll: function () {\r\n \t\tthis._container.scrollTop = 0;\r\n \t\tthis._container.scrollLeft = 0;\r\n \t},\r\n\r\n \t_onMoveEnd: function () {\r\n \t\tvar pos = this._getMapPanePos();\r\n \t\tif (Math.max(Math.abs(pos.x), Math.abs(pos.y)) >= this.options.transform3DLimit) {\r\n \t\t\t// https://bugzilla.mozilla.org/show_bug.cgi?id=1203873 but Webkit also have\r\n \t\t\t// a pixel offset on very high values, see: http://jsfiddle.net/dg6r5hhb/\r\n \t\t\tthis._resetView(this.getCenter(), this.getZoom());\r\n \t\t}\r\n \t},\r\n\r\n \t_findEventTargets: function (e, type) {\r\n \t\tvar targets = [],\r\n \t\t target,\r\n \t\t isHover = type === 'mouseout' || type === 'mouseover',\r\n \t\t src = e.target || e.srcElement,\r\n \t\t dragging = false;\r\n\r\n \t\twhile (src) {\r\n \t\t\ttarget = this._targets[stamp(src)];\r\n \t\t\tif (target && (type === 'click' || type === 'preclick') && !e._simulated && this._draggableMoved(target)) {\r\n \t\t\t\t// Prevent firing click after you just dragged an object.\r\n \t\t\t\tdragging = true;\r\n \t\t\t\tbreak;\r\n \t\t\t}\r\n \t\t\tif (target && target.listens(type, true)) {\r\n \t\t\t\tif (isHover && !isExternalTarget(src, e)) { break; }\r\n \t\t\t\ttargets.push(target);\r\n \t\t\t\tif (isHover) { break; }\r\n \t\t\t}\r\n \t\t\tif (src === this._container) { break; }\r\n \t\t\tsrc = src.parentNode;\r\n \t\t}\r\n \t\tif (!targets.length && !dragging && !isHover && isExternalTarget(src, e)) {\r\n \t\t\ttargets = [this];\r\n \t\t}\r\n \t\treturn targets;\r\n \t},\r\n\r\n \t_handleDOMEvent: function (e) {\r\n \t\tif (!this._loaded || skipped(e)) { return; }\r\n\r\n \t\tvar type = e.type;\r\n\r\n \t\tif (type === 'mousedown' || type === 'keypress' || type === 'keyup' || type === 'keydown') {\r\n \t\t\t// prevents outline when clicking on keyboard-focusable element\r\n \t\t\tpreventOutline(e.target || e.srcElement);\r\n \t\t}\r\n\r\n \t\tthis._fireDOMEvent(e, type);\r\n \t},\r\n\r\n \t_mouseEvents: ['click', 'dblclick', 'mouseover', 'mouseout', 'contextmenu'],\r\n\r\n \t_fireDOMEvent: function (e, type, targets) {\r\n\r\n \t\tif (e.type === 'click') {\r\n \t\t\t// Fire a synthetic 'preclick' event which propagates up (mainly for closing popups).\r\n \t\t\t// @event preclick: MouseEvent\r\n \t\t\t// Fired before mouse click on the map (sometimes useful when you\r\n \t\t\t// want something to happen on click before any existing click\r\n \t\t\t// handlers start running).\r\n \t\t\tvar synth = extend({}, e);\r\n \t\t\tsynth.type = 'preclick';\r\n \t\t\tthis._fireDOMEvent(synth, synth.type, targets);\r\n \t\t}\r\n\r\n \t\tif (e._stopped) { return; }\r\n\r\n \t\t// Find the layer the event is propagating from and its parents.\r\n \t\ttargets = (targets || []).concat(this._findEventTargets(e, type));\r\n\r\n \t\tif (!targets.length) { return; }\r\n\r\n \t\tvar target = targets[0];\r\n \t\tif (type === 'contextmenu' && target.listens(type, true)) {\r\n \t\t\tpreventDefault(e);\r\n \t\t}\r\n\r\n \t\tvar data = {\r\n \t\t\toriginalEvent: e\r\n \t\t};\r\n\r\n \t\tif (e.type !== 'keypress' && e.type !== 'keydown' && e.type !== 'keyup') {\r\n \t\t\tvar isMarker = target.getLatLng && (!target._radius || target._radius <= 10);\r\n \t\t\tdata.containerPoint = isMarker ?\r\n \t\t\t\tthis.latLngToContainerPoint(target.getLatLng()) : this.mouseEventToContainerPoint(e);\r\n \t\t\tdata.layerPoint = this.containerPointToLayerPoint(data.containerPoint);\r\n \t\t\tdata.latlng = isMarker ? target.getLatLng() : this.layerPointToLatLng(data.layerPoint);\r\n \t\t}\r\n\r\n \t\tfor (var i = 0; i < targets.length; i++) {\r\n \t\t\ttargets[i].fire(type, data, true);\r\n \t\t\tif (data.originalEvent._stopped ||\r\n \t\t\t\t(targets[i].options.bubblingMouseEvents === false && indexOf(this._mouseEvents, type) !== -1)) { return; }\r\n \t\t}\r\n \t},\r\n\r\n \t_draggableMoved: function (obj) {\r\n \t\tobj = obj.dragging && obj.dragging.enabled() ? obj : this;\r\n \t\treturn (obj.dragging && obj.dragging.moved()) || (this.boxZoom && this.boxZoom.moved());\r\n \t},\r\n\r\n \t_clearHandlers: function () {\r\n \t\tfor (var i = 0, len = this._handlers.length; i < len; i++) {\r\n \t\t\tthis._handlers[i].disable();\r\n \t\t}\r\n \t},\r\n\r\n \t// @section Other Methods\r\n\r\n \t// @method whenReady(fn: Function, context?: Object): this\r\n \t// Runs the given function `fn` when the map gets initialized with\r\n \t// a view (center and zoom) and at least one layer, or immediately\r\n \t// if it's already initialized, optionally passing a function context.\r\n \twhenReady: function (callback, context) {\r\n \t\tif (this._loaded) {\r\n \t\t\tcallback.call(context || this, {target: this});\r\n \t\t} else {\r\n \t\t\tthis.on('load', callback, context);\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n\r\n \t// private methods for getting map state\r\n\r\n \t_getMapPanePos: function () {\r\n \t\treturn getPosition(this._mapPane) || new Point(0, 0);\r\n \t},\r\n\r\n \t_moved: function () {\r\n \t\tvar pos = this._getMapPanePos();\r\n \t\treturn pos && !pos.equals([0, 0]);\r\n \t},\r\n\r\n \t_getTopLeftPoint: function (center, zoom) {\r\n \t\tvar pixelOrigin = center && zoom !== undefined ?\r\n \t\t\tthis._getNewPixelOrigin(center, zoom) :\r\n \t\t\tthis.getPixelOrigin();\r\n \t\treturn pixelOrigin.subtract(this._getMapPanePos());\r\n \t},\r\n\r\n \t_getNewPixelOrigin: function (center, zoom) {\r\n \t\tvar viewHalf = this.getSize()._divideBy(2);\r\n \t\treturn this.project(center, zoom)._subtract(viewHalf)._add(this._getMapPanePos())._round();\r\n \t},\r\n\r\n \t_latLngToNewLayerPoint: function (latlng, zoom, center) {\r\n \t\tvar topLeft = this._getNewPixelOrigin(center, zoom);\r\n \t\treturn this.project(latlng, zoom)._subtract(topLeft);\r\n \t},\r\n\r\n \t_latLngBoundsToNewLayerBounds: function (latLngBounds, zoom, center) {\r\n \t\tvar topLeft = this._getNewPixelOrigin(center, zoom);\r\n \t\treturn toBounds([\r\n \t\t\tthis.project(latLngBounds.getSouthWest(), zoom)._subtract(topLeft),\r\n \t\t\tthis.project(latLngBounds.getNorthWest(), zoom)._subtract(topLeft),\r\n \t\t\tthis.project(latLngBounds.getSouthEast(), zoom)._subtract(topLeft),\r\n \t\t\tthis.project(latLngBounds.getNorthEast(), zoom)._subtract(topLeft)\r\n \t\t]);\r\n \t},\r\n\r\n \t// layer point of the current center\r\n \t_getCenterLayerPoint: function () {\r\n \t\treturn this.containerPointToLayerPoint(this.getSize()._divideBy(2));\r\n \t},\r\n\r\n \t// offset of the specified place to the current center in pixels\r\n \t_getCenterOffset: function (latlng) {\r\n \t\treturn this.latLngToLayerPoint(latlng).subtract(this._getCenterLayerPoint());\r\n \t},\r\n\r\n \t// adjust center for view to get inside bounds\r\n \t_limitCenter: function (center, zoom, bounds) {\r\n\r\n \t\tif (!bounds) { return center; }\r\n\r\n \t\tvar centerPoint = this.project(center, zoom),\r\n \t\t viewHalf = this.getSize().divideBy(2),\r\n \t\t viewBounds = new Bounds(centerPoint.subtract(viewHalf), centerPoint.add(viewHalf)),\r\n \t\t offset = this._getBoundsOffset(viewBounds, bounds, zoom);\r\n\r\n \t\t// If offset is less than a pixel, ignore.\r\n \t\t// This prevents unstable projections from getting into\r\n \t\t// an infinite loop of tiny offsets.\r\n \t\tif (offset.round().equals([0, 0])) {\r\n \t\t\treturn center;\r\n \t\t}\r\n\r\n \t\treturn this.unproject(centerPoint.add(offset), zoom);\r\n \t},\r\n\r\n \t// adjust offset for view to get inside bounds\r\n \t_limitOffset: function (offset, bounds) {\r\n \t\tif (!bounds) { return offset; }\r\n\r\n \t\tvar viewBounds = this.getPixelBounds(),\r\n \t\t newBounds = new Bounds(viewBounds.min.add(offset), viewBounds.max.add(offset));\r\n\r\n \t\treturn offset.add(this._getBoundsOffset(newBounds, bounds));\r\n \t},\r\n\r\n \t// returns offset needed for pxBounds to get inside maxBounds at a specified zoom\r\n \t_getBoundsOffset: function (pxBounds, maxBounds, zoom) {\r\n \t\tvar projectedMaxBounds = toBounds(\r\n \t\t this.project(maxBounds.getNorthEast(), zoom),\r\n \t\t this.project(maxBounds.getSouthWest(), zoom)\r\n \t\t ),\r\n \t\t minOffset = projectedMaxBounds.min.subtract(pxBounds.min),\r\n \t\t maxOffset = projectedMaxBounds.max.subtract(pxBounds.max),\r\n\r\n \t\t dx = this._rebound(minOffset.x, -maxOffset.x),\r\n \t\t dy = this._rebound(minOffset.y, -maxOffset.y);\r\n\r\n \t\treturn new Point(dx, dy);\r\n \t},\r\n\r\n \t_rebound: function (left, right) {\r\n \t\treturn left + right > 0 ?\r\n \t\t\tMath.round(left - right) / 2 :\r\n \t\t\tMath.max(0, Math.ceil(left)) - Math.max(0, Math.floor(right));\r\n \t},\r\n\r\n \t_limitZoom: function (zoom) {\r\n \t\tvar min = this.getMinZoom(),\r\n \t\t max = this.getMaxZoom(),\r\n \t\t snap = any3d ? this.options.zoomSnap : 1;\r\n \t\tif (snap) {\r\n \t\t\tzoom = Math.round(zoom / snap) * snap;\r\n \t\t}\r\n \t\treturn Math.max(min, Math.min(max, zoom));\r\n \t},\r\n\r\n \t_onPanTransitionStep: function () {\r\n \t\tthis.fire('move');\r\n \t},\r\n\r\n \t_onPanTransitionEnd: function () {\r\n \t\tremoveClass(this._mapPane, 'leaflet-pan-anim');\r\n \t\tthis.fire('moveend');\r\n \t},\r\n\r\n \t_tryAnimatedPan: function (center, options) {\r\n \t\t// difference between the new and current centers in pixels\r\n \t\tvar offset = this._getCenterOffset(center)._trunc();\r\n\r\n \t\t// don't animate too far unless animate: true specified in options\r\n \t\tif ((options && options.animate) !== true && !this.getSize().contains(offset)) { return false; }\r\n\r\n \t\tthis.panBy(offset, options);\r\n\r\n \t\treturn true;\r\n \t},\r\n\r\n \t_createAnimProxy: function () {\r\n\r\n \t\tvar proxy = this._proxy = create$1('div', 'leaflet-proxy leaflet-zoom-animated');\r\n \t\tthis._panes.mapPane.appendChild(proxy);\r\n\r\n \t\tthis.on('zoomanim', function (e) {\r\n \t\t\tvar prop = TRANSFORM,\r\n \t\t\t transform = this._proxy.style[prop];\r\n\r\n \t\t\tsetTransform(this._proxy, this.project(e.center, e.zoom), this.getZoomScale(e.zoom, 1));\r\n\r\n \t\t\t// workaround for case when transform is the same and so transitionend event is not fired\r\n \t\t\tif (transform === this._proxy.style[prop] && this._animatingZoom) {\r\n \t\t\t\tthis._onZoomTransitionEnd();\r\n \t\t\t}\r\n \t\t}, this);\r\n\r\n \t\tthis.on('load moveend', this._animMoveEnd, this);\r\n\r\n \t\tthis._on('unload', this._destroyAnimProxy, this);\r\n \t},\r\n\r\n \t_destroyAnimProxy: function () {\r\n \t\tremove(this._proxy);\r\n \t\tthis.off('load moveend', this._animMoveEnd, this);\r\n \t\tdelete this._proxy;\r\n \t},\r\n\r\n \t_animMoveEnd: function () {\r\n \t\tvar c = this.getCenter(),\r\n \t\t z = this.getZoom();\r\n \t\tsetTransform(this._proxy, this.project(c, z), this.getZoomScale(z, 1));\r\n \t},\r\n\r\n \t_catchTransitionEnd: function (e) {\r\n \t\tif (this._animatingZoom && e.propertyName.indexOf('transform') >= 0) {\r\n \t\t\tthis._onZoomTransitionEnd();\r\n \t\t}\r\n \t},\r\n\r\n \t_nothingToAnimate: function () {\r\n \t\treturn !this._container.getElementsByClassName('leaflet-zoom-animated').length;\r\n \t},\r\n\r\n \t_tryAnimatedZoom: function (center, zoom, options) {\r\n\r\n \t\tif (this._animatingZoom) { return true; }\r\n\r\n \t\toptions = options || {};\r\n\r\n \t\t// don't animate if disabled, not supported or zoom difference is too large\r\n \t\tif (!this._zoomAnimated || options.animate === false || this._nothingToAnimate() ||\r\n \t\t Math.abs(zoom - this._zoom) > this.options.zoomAnimationThreshold) { return false; }\r\n\r\n \t\t// offset is the pixel coords of the zoom origin relative to the current center\r\n \t\tvar scale = this.getZoomScale(zoom),\r\n \t\t offset = this._getCenterOffset(center)._divideBy(1 - 1 / scale);\r\n\r\n \t\t// don't animate if the zoom origin isn't within one screen from the current center, unless forced\r\n \t\tif (options.animate !== true && !this.getSize().contains(offset)) { return false; }\r\n\r\n \t\trequestAnimFrame(function () {\r\n \t\t\tthis\r\n \t\t\t ._moveStart(true, false)\r\n \t\t\t ._animateZoom(center, zoom, true);\r\n \t\t}, this);\r\n\r\n \t\treturn true;\r\n \t},\r\n\r\n \t_animateZoom: function (center, zoom, startAnim, noUpdate) {\r\n \t\tif (!this._mapPane) { return; }\r\n\r\n \t\tif (startAnim) {\r\n \t\t\tthis._animatingZoom = true;\r\n\r\n \t\t\t// remember what center/zoom to set after animation\r\n \t\t\tthis._animateToCenter = center;\r\n \t\t\tthis._animateToZoom = zoom;\r\n\r\n \t\t\taddClass(this._mapPane, 'leaflet-zoom-anim');\r\n \t\t}\r\n\r\n \t\t// @section Other Events\r\n \t\t// @event zoomanim: ZoomAnimEvent\r\n \t\t// Fired at least once per zoom animation. For continuous zoom, like pinch zooming, fired once per frame during zoom.\r\n \t\tthis.fire('zoomanim', {\r\n \t\t\tcenter: center,\r\n \t\t\tzoom: zoom,\r\n \t\t\tnoUpdate: noUpdate\r\n \t\t});\r\n\r\n \t\t// Work around webkit not firing 'transitionend', see https://github.com/Leaflet/Leaflet/issues/3689, 2693\r\n \t\tsetTimeout(bind(this._onZoomTransitionEnd, this), 250);\r\n \t},\r\n\r\n \t_onZoomTransitionEnd: function () {\r\n \t\tif (!this._animatingZoom) { return; }\r\n\r\n \t\tif (this._mapPane) {\r\n \t\t\tremoveClass(this._mapPane, 'leaflet-zoom-anim');\r\n \t\t}\r\n\r\n \t\tthis._animatingZoom = false;\r\n\r\n \t\tthis._move(this._animateToCenter, this._animateToZoom);\r\n\r\n \t\t// This anim frame should prevent an obscure iOS webkit tile loading race condition.\r\n \t\trequestAnimFrame(function () {\r\n \t\t\tthis._moveEnd(true);\r\n \t\t}, this);\r\n \t}\r\n });\r\n\r\n // @section\r\n\r\n // @factory L.map(id: String, options?: Map options)\r\n // Instantiates a map object given the DOM ID of a `
` element\r\n // and optionally an object literal with `Map options`.\r\n //\r\n // @alternative\r\n // @factory L.map(el: HTMLElement, options?: Map options)\r\n // Instantiates a map object given an instance of a `
` HTML element\r\n // and optionally an object literal with `Map options`.\r\n function createMap(id, options) {\r\n \treturn new Map(id, options);\r\n }\n\n /*\r\n * @class Control\r\n * @aka L.Control\r\n * @inherits Class\r\n *\r\n * L.Control is a base class for implementing map controls. Handles positioning.\r\n * All other controls extend from this class.\r\n */\r\n\r\n var Control = Class.extend({\r\n \t// @section\r\n \t// @aka Control options\r\n \toptions: {\r\n \t\t// @option position: String = 'topright'\r\n \t\t// The position of the control (one of the map corners). Possible values are `'topleft'`,\r\n \t\t// `'topright'`, `'bottomleft'` or `'bottomright'`\r\n \t\tposition: 'topright'\r\n \t},\r\n\r\n \tinitialize: function (options) {\r\n \t\tsetOptions(this, options);\r\n \t},\r\n\r\n \t/* @section\r\n \t * Classes extending L.Control will inherit the following methods:\r\n \t *\r\n \t * @method getPosition: string\r\n \t * Returns the position of the control.\r\n \t */\r\n \tgetPosition: function () {\r\n \t\treturn this.options.position;\r\n \t},\r\n\r\n \t// @method setPosition(position: string): this\r\n \t// Sets the position of the control.\r\n \tsetPosition: function (position) {\r\n \t\tvar map = this._map;\r\n\r\n \t\tif (map) {\r\n \t\t\tmap.removeControl(this);\r\n \t\t}\r\n\r\n \t\tthis.options.position = position;\r\n\r\n \t\tif (map) {\r\n \t\t\tmap.addControl(this);\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method getContainer: HTMLElement\r\n \t// Returns the HTMLElement that contains the control.\r\n \tgetContainer: function () {\r\n \t\treturn this._container;\r\n \t},\r\n\r\n \t// @method addTo(map: Map): this\r\n \t// Adds the control to the given map.\r\n \taddTo: function (map) {\r\n \t\tthis.remove();\r\n \t\tthis._map = map;\r\n\r\n \t\tvar container = this._container = this.onAdd(map),\r\n \t\t pos = this.getPosition(),\r\n \t\t corner = map._controlCorners[pos];\r\n\r\n \t\taddClass(container, 'leaflet-control');\r\n\r\n \t\tif (pos.indexOf('bottom') !== -1) {\r\n \t\t\tcorner.insertBefore(container, corner.firstChild);\r\n \t\t} else {\r\n \t\t\tcorner.appendChild(container);\r\n \t\t}\r\n\r\n \t\tthis._map.on('unload', this.remove, this);\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method remove: this\r\n \t// Removes the control from the map it is currently active on.\r\n \tremove: function () {\r\n \t\tif (!this._map) {\r\n \t\t\treturn this;\r\n \t\t}\r\n\r\n \t\tremove(this._container);\r\n\r\n \t\tif (this.onRemove) {\r\n \t\t\tthis.onRemove(this._map);\r\n \t\t}\r\n\r\n \t\tthis._map.off('unload', this.remove, this);\r\n \t\tthis._map = null;\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t_refocusOnMap: function (e) {\r\n \t\t// if map exists and event is not a keyboard event\r\n \t\tif (this._map && e && e.screenX > 0 && e.screenY > 0) {\r\n \t\t\tthis._map.getContainer().focus();\r\n \t\t}\r\n \t}\r\n });\r\n\r\n var control = function (options) {\r\n \treturn new Control(options);\r\n };\r\n\r\n /* @section Extension methods\r\n * @uninheritable\r\n *\r\n * Every control should extend from `L.Control` and (re-)implement the following methods.\r\n *\r\n * @method onAdd(map: Map): HTMLElement\r\n * Should return the container DOM element for the control and add listeners on relevant map events. Called on [`control.addTo(map)`](#control-addTo).\r\n *\r\n * @method onRemove(map: Map)\r\n * Optional method. Should contain all clean up code that removes the listeners previously added in [`onAdd`](#control-onadd). Called on [`control.remove()`](#control-remove).\r\n */\r\n\r\n /* @namespace Map\r\n * @section Methods for Layers and Controls\r\n */\r\n Map.include({\r\n \t// @method addControl(control: Control): this\r\n \t// Adds the given control to the map\r\n \taddControl: function (control) {\r\n \t\tcontrol.addTo(this);\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method removeControl(control: Control): this\r\n \t// Removes the given control from the map\r\n \tremoveControl: function (control) {\r\n \t\tcontrol.remove();\r\n \t\treturn this;\r\n \t},\r\n\r\n \t_initControlPos: function () {\r\n \t\tvar corners = this._controlCorners = {},\r\n \t\t l = 'leaflet-',\r\n \t\t container = this._controlContainer =\r\n \t\t create$1('div', l + 'control-container', this._container);\r\n\r\n \t\tfunction createCorner(vSide, hSide) {\r\n \t\t\tvar className = l + vSide + ' ' + l + hSide;\r\n\r\n \t\t\tcorners[vSide + hSide] = create$1('div', className, container);\r\n \t\t}\r\n\r\n \t\tcreateCorner('top', 'left');\r\n \t\tcreateCorner('top', 'right');\r\n \t\tcreateCorner('bottom', 'left');\r\n \t\tcreateCorner('bottom', 'right');\r\n \t},\r\n\r\n \t_clearControlPos: function () {\r\n \t\tfor (var i in this._controlCorners) {\r\n \t\t\tremove(this._controlCorners[i]);\r\n \t\t}\r\n \t\tremove(this._controlContainer);\r\n \t\tdelete this._controlCorners;\r\n \t\tdelete this._controlContainer;\r\n \t}\r\n });\n\n /*\r\n * @class Control.Layers\r\n * @aka L.Control.Layers\r\n * @inherits Control\r\n *\r\n * The layers control gives users the ability to switch between different base layers and switch overlays on/off (check out the [detailed example](http://leafletjs.com/examples/layers-control/)). Extends `Control`.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * var baseLayers = {\r\n * \t\"Mapbox\": mapbox,\r\n * \t\"OpenStreetMap\": osm\r\n * };\r\n *\r\n * var overlays = {\r\n * \t\"Marker\": marker,\r\n * \t\"Roads\": roadsLayer\r\n * };\r\n *\r\n * L.control.layers(baseLayers, overlays).addTo(map);\r\n * ```\r\n *\r\n * The `baseLayers` and `overlays` parameters are object literals with layer names as keys and `Layer` objects as values:\r\n *\r\n * ```js\r\n * {\r\n * \"\": layer1,\r\n * \"\": layer2\r\n * }\r\n * ```\r\n *\r\n * The layer names can contain HTML, which allows you to add additional styling to the items:\r\n *\r\n * ```js\r\n * {\" My Layer\": myLayer}\r\n * ```\r\n */\r\n\r\n var Layers = Control.extend({\r\n \t// @section\r\n \t// @aka Control.Layers options\r\n \toptions: {\r\n \t\t// @option collapsed: Boolean = true\r\n \t\t// If `true`, the control will be collapsed into an icon and expanded on mouse hover or touch.\r\n \t\tcollapsed: true,\r\n \t\tposition: 'topright',\r\n\r\n \t\t// @option autoZIndex: Boolean = true\r\n \t\t// If `true`, the control will assign zIndexes in increasing order to all of its layers so that the order is preserved when switching them on/off.\r\n \t\tautoZIndex: true,\r\n\r\n \t\t// @option hideSingleBase: Boolean = false\r\n \t\t// If `true`, the base layers in the control will be hidden when there is only one.\r\n \t\thideSingleBase: false,\r\n\r\n \t\t// @option sortLayers: Boolean = false\r\n \t\t// Whether to sort the layers. When `false`, layers will keep the order\r\n \t\t// in which they were added to the control.\r\n \t\tsortLayers: false,\r\n\r\n \t\t// @option sortFunction: Function = *\r\n \t\t// A [compare function](https://developer.mozilla.org/docs/Web/JavaScript/Reference/Global_Objects/Array/sort)\r\n \t\t// that will be used for sorting the layers, when `sortLayers` is `true`.\r\n \t\t// The function receives both the `L.Layer` instances and their names, as in\r\n \t\t// `sortFunction(layerA, layerB, nameA, nameB)`.\r\n \t\t// By default, it sorts layers alphabetically by their name.\r\n \t\tsortFunction: function (layerA, layerB, nameA, nameB) {\r\n \t\t\treturn nameA < nameB ? -1 : (nameB < nameA ? 1 : 0);\r\n \t\t}\r\n \t},\r\n\r\n \tinitialize: function (baseLayers, overlays, options) {\r\n \t\tsetOptions(this, options);\r\n\r\n \t\tthis._layerControlInputs = [];\r\n \t\tthis._layers = [];\r\n \t\tthis._lastZIndex = 0;\r\n \t\tthis._handlingClick = false;\r\n\r\n \t\tfor (var i in baseLayers) {\r\n \t\t\tthis._addLayer(baseLayers[i], i);\r\n \t\t}\r\n\r\n \t\tfor (i in overlays) {\r\n \t\t\tthis._addLayer(overlays[i], i, true);\r\n \t\t}\r\n \t},\r\n\r\n \tonAdd: function (map) {\r\n \t\tthis._initLayout();\r\n \t\tthis._update();\r\n\r\n \t\tthis._map = map;\r\n \t\tmap.on('zoomend', this._checkDisabledLayers, this);\r\n\r\n \t\tfor (var i = 0; i < this._layers.length; i++) {\r\n \t\t\tthis._layers[i].layer.on('add remove', this._onLayerChange, this);\r\n \t\t}\r\n\r\n \t\treturn this._container;\r\n \t},\r\n\r\n \taddTo: function (map) {\r\n \t\tControl.prototype.addTo.call(this, map);\r\n \t\t// Trigger expand after Layers Control has been inserted into DOM so that is now has an actual height.\r\n \t\treturn this._expandIfNotCollapsed();\r\n \t},\r\n\r\n \tonRemove: function () {\r\n \t\tthis._map.off('zoomend', this._checkDisabledLayers, this);\r\n\r\n \t\tfor (var i = 0; i < this._layers.length; i++) {\r\n \t\t\tthis._layers[i].layer.off('add remove', this._onLayerChange, this);\r\n \t\t}\r\n \t},\r\n\r\n \t// @method addBaseLayer(layer: Layer, name: String): this\r\n \t// Adds a base layer (radio button entry) with the given name to the control.\r\n \taddBaseLayer: function (layer, name) {\r\n \t\tthis._addLayer(layer, name);\r\n \t\treturn (this._map) ? this._update() : this;\r\n \t},\r\n\r\n \t// @method addOverlay(layer: Layer, name: String): this\r\n \t// Adds an overlay (checkbox entry) with the given name to the control.\r\n \taddOverlay: function (layer, name) {\r\n \t\tthis._addLayer(layer, name, true);\r\n \t\treturn (this._map) ? this._update() : this;\r\n \t},\r\n\r\n \t// @method removeLayer(layer: Layer): this\r\n \t// Remove the given layer from the control.\r\n \tremoveLayer: function (layer) {\r\n \t\tlayer.off('add remove', this._onLayerChange, this);\r\n\r\n \t\tvar obj = this._getLayer(stamp(layer));\r\n \t\tif (obj) {\r\n \t\t\tthis._layers.splice(this._layers.indexOf(obj), 1);\r\n \t\t}\r\n \t\treturn (this._map) ? this._update() : this;\r\n \t},\r\n\r\n \t// @method expand(): this\r\n \t// Expand the control container if collapsed.\r\n \texpand: function () {\r\n \t\taddClass(this._container, 'leaflet-control-layers-expanded');\r\n \t\tthis._section.style.height = null;\r\n \t\tvar acceptableHeight = this._map.getSize().y - (this._container.offsetTop + 50);\r\n \t\tif (acceptableHeight < this._section.clientHeight) {\r\n \t\t\taddClass(this._section, 'leaflet-control-layers-scrollbar');\r\n \t\t\tthis._section.style.height = acceptableHeight + 'px';\r\n \t\t} else {\r\n \t\t\tremoveClass(this._section, 'leaflet-control-layers-scrollbar');\r\n \t\t}\r\n \t\tthis._checkDisabledLayers();\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method collapse(): this\r\n \t// Collapse the control container if expanded.\r\n \tcollapse: function () {\r\n \t\tremoveClass(this._container, 'leaflet-control-layers-expanded');\r\n \t\treturn this;\r\n \t},\r\n\r\n \t_initLayout: function () {\r\n \t\tvar className = 'leaflet-control-layers',\r\n \t\t container = this._container = create$1('div', className),\r\n \t\t collapsed = this.options.collapsed;\r\n\r\n \t\t// makes this work on IE touch devices by stopping it from firing a mouseout event when the touch is released\r\n \t\tcontainer.setAttribute('aria-haspopup', true);\r\n\r\n \t\tdisableClickPropagation(container);\r\n \t\tdisableScrollPropagation(container);\r\n\r\n \t\tvar section = this._section = create$1('section', className + '-list');\r\n\r\n \t\tif (collapsed) {\r\n \t\t\tthis._map.on('click', this.collapse, this);\r\n\r\n \t\t\tif (!android) {\r\n \t\t\t\ton(container, {\r\n \t\t\t\t\tmouseenter: this.expand,\r\n \t\t\t\t\tmouseleave: this.collapse\r\n \t\t\t\t}, this);\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\tvar link = this._layersLink = create$1('a', className + '-toggle', container);\r\n \t\tlink.href = '#';\r\n \t\tlink.title = 'Layers';\r\n\r\n \t\tif (touch) {\r\n \t\t\ton(link, 'click', stop);\r\n \t\t\ton(link, 'click', this.expand, this);\r\n \t\t} else {\r\n \t\t\ton(link, 'focus', this.expand, this);\r\n \t\t}\r\n\r\n \t\tif (!collapsed) {\r\n \t\t\tthis.expand();\r\n \t\t}\r\n\r\n \t\tthis._baseLayersList = create$1('div', className + '-base', section);\r\n \t\tthis._separator = create$1('div', className + '-separator', section);\r\n \t\tthis._overlaysList = create$1('div', className + '-overlays', section);\r\n\r\n \t\tcontainer.appendChild(section);\r\n \t},\r\n\r\n \t_getLayer: function (id) {\r\n \t\tfor (var i = 0; i < this._layers.length; i++) {\r\n\r\n \t\t\tif (this._layers[i] && stamp(this._layers[i].layer) === id) {\r\n \t\t\t\treturn this._layers[i];\r\n \t\t\t}\r\n \t\t}\r\n \t},\r\n\r\n \t_addLayer: function (layer, name, overlay) {\r\n \t\tif (this._map) {\r\n \t\t\tlayer.on('add remove', this._onLayerChange, this);\r\n \t\t}\r\n\r\n \t\tthis._layers.push({\r\n \t\t\tlayer: layer,\r\n \t\t\tname: name,\r\n \t\t\toverlay: overlay\r\n \t\t});\r\n\r\n \t\tif (this.options.sortLayers) {\r\n \t\t\tthis._layers.sort(bind(function (a, b) {\r\n \t\t\t\treturn this.options.sortFunction(a.layer, b.layer, a.name, b.name);\r\n \t\t\t}, this));\r\n \t\t}\r\n\r\n \t\tif (this.options.autoZIndex && layer.setZIndex) {\r\n \t\t\tthis._lastZIndex++;\r\n \t\t\tlayer.setZIndex(this._lastZIndex);\r\n \t\t}\r\n\r\n \t\tthis._expandIfNotCollapsed();\r\n \t},\r\n\r\n \t_update: function () {\r\n \t\tif (!this._container) { return this; }\r\n\r\n \t\tempty(this._baseLayersList);\r\n \t\tempty(this._overlaysList);\r\n\r\n \t\tthis._layerControlInputs = [];\r\n \t\tvar baseLayersPresent, overlaysPresent, i, obj, baseLayersCount = 0;\r\n\r\n \t\tfor (i = 0; i < this._layers.length; i++) {\r\n \t\t\tobj = this._layers[i];\r\n \t\t\tthis._addItem(obj);\r\n \t\t\toverlaysPresent = overlaysPresent || obj.overlay;\r\n \t\t\tbaseLayersPresent = baseLayersPresent || !obj.overlay;\r\n \t\t\tbaseLayersCount += !obj.overlay ? 1 : 0;\r\n \t\t}\r\n\r\n \t\t// Hide base layers section if there's only one layer.\r\n \t\tif (this.options.hideSingleBase) {\r\n \t\t\tbaseLayersPresent = baseLayersPresent && baseLayersCount > 1;\r\n \t\t\tthis._baseLayersList.style.display = baseLayersPresent ? '' : 'none';\r\n \t\t}\r\n\r\n \t\tthis._separator.style.display = overlaysPresent && baseLayersPresent ? '' : 'none';\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t_onLayerChange: function (e) {\r\n \t\tif (!this._handlingClick) {\r\n \t\t\tthis._update();\r\n \t\t}\r\n\r\n \t\tvar obj = this._getLayer(stamp(e.target));\r\n\r\n \t\t// @namespace Map\r\n \t\t// @section Layer events\r\n \t\t// @event baselayerchange: LayersControlEvent\r\n \t\t// Fired when the base layer is changed through the [layers control](#control-layers).\r\n \t\t// @event overlayadd: LayersControlEvent\r\n \t\t// Fired when an overlay is selected through the [layers control](#control-layers).\r\n \t\t// @event overlayremove: LayersControlEvent\r\n \t\t// Fired when an overlay is deselected through the [layers control](#control-layers).\r\n \t\t// @namespace Control.Layers\r\n \t\tvar type = obj.overlay ?\r\n \t\t\t(e.type === 'add' ? 'overlayadd' : 'overlayremove') :\r\n \t\t\t(e.type === 'add' ? 'baselayerchange' : null);\r\n\r\n \t\tif (type) {\r\n \t\t\tthis._map.fire(type, obj);\r\n \t\t}\r\n \t},\r\n\r\n \t// IE7 bugs out if you create a radio dynamically, so you have to do it this hacky way (see http://bit.ly/PqYLBe)\r\n \t_createRadioElement: function (name, checked) {\r\n\r\n \t\tvar radioHtml = '';\r\n\r\n \t\tvar radioFragment = document.createElement('div');\r\n \t\tradioFragment.innerHTML = radioHtml;\r\n\r\n \t\treturn radioFragment.firstChild;\r\n \t},\r\n\r\n \t_addItem: function (obj) {\r\n \t\tvar label = document.createElement('label'),\r\n \t\t checked = this._map.hasLayer(obj.layer),\r\n \t\t input;\r\n\r\n \t\tif (obj.overlay) {\r\n \t\t\tinput = document.createElement('input');\r\n \t\t\tinput.type = 'checkbox';\r\n \t\t\tinput.className = 'leaflet-control-layers-selector';\r\n \t\t\tinput.defaultChecked = checked;\r\n \t\t} else {\r\n \t\t\tinput = this._createRadioElement('leaflet-base-layers_' + stamp(this), checked);\r\n \t\t}\r\n\r\n \t\tthis._layerControlInputs.push(input);\r\n \t\tinput.layerId = stamp(obj.layer);\r\n\r\n \t\ton(input, 'click', this._onInputClick, this);\r\n\r\n \t\tvar name = document.createElement('span');\r\n \t\tname.innerHTML = ' ' + obj.name;\r\n\r\n \t\t// Helps from preventing layer control flicker when checkboxes are disabled\r\n \t\t// https://github.com/Leaflet/Leaflet/issues/2771\r\n \t\tvar holder = document.createElement('div');\r\n\r\n \t\tlabel.appendChild(holder);\r\n \t\tholder.appendChild(input);\r\n \t\tholder.appendChild(name);\r\n\r\n \t\tvar container = obj.overlay ? this._overlaysList : this._baseLayersList;\r\n \t\tcontainer.appendChild(label);\r\n\r\n \t\tthis._checkDisabledLayers();\r\n \t\treturn label;\r\n \t},\r\n\r\n \t_onInputClick: function () {\r\n \t\tvar inputs = this._layerControlInputs,\r\n \t\t input, layer;\r\n \t\tvar addedLayers = [],\r\n \t\t removedLayers = [];\r\n\r\n \t\tthis._handlingClick = true;\r\n\r\n \t\tfor (var i = inputs.length - 1; i >= 0; i--) {\r\n \t\t\tinput = inputs[i];\r\n \t\t\tlayer = this._getLayer(input.layerId).layer;\r\n\r\n \t\t\tif (input.checked) {\r\n \t\t\t\taddedLayers.push(layer);\r\n \t\t\t} else if (!input.checked) {\r\n \t\t\t\tremovedLayers.push(layer);\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\t// Bugfix issue 2318: Should remove all old layers before readding new ones\r\n \t\tfor (i = 0; i < removedLayers.length; i++) {\r\n \t\t\tif (this._map.hasLayer(removedLayers[i])) {\r\n \t\t\t\tthis._map.removeLayer(removedLayers[i]);\r\n \t\t\t}\r\n \t\t}\r\n \t\tfor (i = 0; i < addedLayers.length; i++) {\r\n \t\t\tif (!this._map.hasLayer(addedLayers[i])) {\r\n \t\t\t\tthis._map.addLayer(addedLayers[i]);\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\tthis._handlingClick = false;\r\n\r\n \t\tthis._refocusOnMap();\r\n \t},\r\n\r\n \t_checkDisabledLayers: function () {\r\n \t\tvar inputs = this._layerControlInputs,\r\n \t\t input,\r\n \t\t layer,\r\n \t\t zoom = this._map.getZoom();\r\n\r\n \t\tfor (var i = inputs.length - 1; i >= 0; i--) {\r\n \t\t\tinput = inputs[i];\r\n \t\t\tlayer = this._getLayer(input.layerId).layer;\r\n \t\t\tinput.disabled = (layer.options.minZoom !== undefined && zoom < layer.options.minZoom) ||\r\n \t\t\t (layer.options.maxZoom !== undefined && zoom > layer.options.maxZoom);\r\n\r\n \t\t}\r\n \t},\r\n\r\n \t_expandIfNotCollapsed: function () {\r\n \t\tif (this._map && !this.options.collapsed) {\r\n \t\t\tthis.expand();\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \t_expand: function () {\r\n \t\t// Backward compatibility, remove me in 1.1.\r\n \t\treturn this.expand();\r\n \t},\r\n\r\n \t_collapse: function () {\r\n \t\t// Backward compatibility, remove me in 1.1.\r\n \t\treturn this.collapse();\r\n \t}\r\n\r\n });\r\n\r\n\r\n // @factory L.control.layers(baselayers?: Object, overlays?: Object, options?: Control.Layers options)\r\n // Creates a layers control with the given layers. Base layers will be switched with radio buttons, while overlays will be switched with checkboxes. Note that all base layers should be passed in the base layers object, but only one should be added to the map during map instantiation.\r\n var layers = function (baseLayers, overlays, options) {\r\n \treturn new Layers(baseLayers, overlays, options);\r\n };\n\n /*\r\n * @class Control.Zoom\r\n * @aka L.Control.Zoom\r\n * @inherits Control\r\n *\r\n * A basic zoom control with two buttons (zoom in and zoom out). It is put on the map by default unless you set its [`zoomControl` option](#map-zoomcontrol) to `false`. Extends `Control`.\r\n */\r\n\r\n var Zoom = Control.extend({\r\n \t// @section\r\n \t// @aka Control.Zoom options\r\n \toptions: {\r\n \t\tposition: 'topleft',\r\n\r\n \t\t// @option zoomInText: String = '+'\r\n \t\t// The text set on the 'zoom in' button.\r\n \t\tzoomInText: '+',\r\n\r\n \t\t// @option zoomInTitle: String = 'Zoom in'\r\n \t\t// The title set on the 'zoom in' button.\r\n \t\tzoomInTitle: 'Zoom in',\r\n\r\n \t\t// @option zoomOutText: String = '−'\r\n \t\t// The text set on the 'zoom out' button.\r\n \t\tzoomOutText: '−',\r\n\r\n \t\t// @option zoomOutTitle: String = 'Zoom out'\r\n \t\t// The title set on the 'zoom out' button.\r\n \t\tzoomOutTitle: 'Zoom out'\r\n \t},\r\n\r\n \tonAdd: function (map) {\r\n \t\tvar zoomName = 'leaflet-control-zoom',\r\n \t\t container = create$1('div', zoomName + ' leaflet-bar'),\r\n \t\t options = this.options;\r\n\r\n \t\tthis._zoomInButton = this._createButton(options.zoomInText, options.zoomInTitle,\r\n \t\t zoomName + '-in', container, this._zoomIn);\r\n \t\tthis._zoomOutButton = this._createButton(options.zoomOutText, options.zoomOutTitle,\r\n \t\t zoomName + '-out', container, this._zoomOut);\r\n\r\n \t\tthis._updateDisabled();\r\n \t\tmap.on('zoomend zoomlevelschange', this._updateDisabled, this);\r\n\r\n \t\treturn container;\r\n \t},\r\n\r\n \tonRemove: function (map) {\r\n \t\tmap.off('zoomend zoomlevelschange', this._updateDisabled, this);\r\n \t},\r\n\r\n \tdisable: function () {\r\n \t\tthis._disabled = true;\r\n \t\tthis._updateDisabled();\r\n \t\treturn this;\r\n \t},\r\n\r\n \tenable: function () {\r\n \t\tthis._disabled = false;\r\n \t\tthis._updateDisabled();\r\n \t\treturn this;\r\n \t},\r\n\r\n \t_zoomIn: function (e) {\r\n \t\tif (!this._disabled && this._map._zoom < this._map.getMaxZoom()) {\r\n \t\t\tthis._map.zoomIn(this._map.options.zoomDelta * (e.shiftKey ? 3 : 1));\r\n \t\t}\r\n \t},\r\n\r\n \t_zoomOut: function (e) {\r\n \t\tif (!this._disabled && this._map._zoom > this._map.getMinZoom()) {\r\n \t\t\tthis._map.zoomOut(this._map.options.zoomDelta * (e.shiftKey ? 3 : 1));\r\n \t\t}\r\n \t},\r\n\r\n \t_createButton: function (html, title, className, container, fn) {\r\n \t\tvar link = create$1('a', className, container);\r\n \t\tlink.innerHTML = html;\r\n \t\tlink.href = '#';\r\n \t\tlink.title = title;\r\n\r\n \t\t/*\r\n \t\t * Will force screen readers like VoiceOver to read this as \"Zoom in - button\"\r\n \t\t */\r\n \t\tlink.setAttribute('role', 'button');\r\n \t\tlink.setAttribute('aria-label', title);\r\n\r\n \t\tdisableClickPropagation(link);\r\n \t\ton(link, 'click', stop);\r\n \t\ton(link, 'click', fn, this);\r\n \t\ton(link, 'click', this._refocusOnMap, this);\r\n\r\n \t\treturn link;\r\n \t},\r\n\r\n \t_updateDisabled: function () {\r\n \t\tvar map = this._map,\r\n \t\t className = 'leaflet-disabled';\r\n\r\n \t\tremoveClass(this._zoomInButton, className);\r\n \t\tremoveClass(this._zoomOutButton, className);\r\n\r\n \t\tif (this._disabled || map._zoom === map.getMinZoom()) {\r\n \t\t\taddClass(this._zoomOutButton, className);\r\n \t\t}\r\n \t\tif (this._disabled || map._zoom === map.getMaxZoom()) {\r\n \t\t\taddClass(this._zoomInButton, className);\r\n \t\t}\r\n \t}\r\n });\r\n\r\n // @namespace Map\r\n // @section Control options\r\n // @option zoomControl: Boolean = true\r\n // Whether a [zoom control](#control-zoom) is added to the map by default.\r\n Map.mergeOptions({\r\n \tzoomControl: true\r\n });\r\n\r\n Map.addInitHook(function () {\r\n \tif (this.options.zoomControl) {\r\n \t\t// @section Controls\r\n \t\t// @property zoomControl: Control.Zoom\r\n \t\t// The default zoom control (only available if the\r\n \t\t// [`zoomControl` option](#map-zoomcontrol) was `true` when creating the map).\r\n \t\tthis.zoomControl = new Zoom();\r\n \t\tthis.addControl(this.zoomControl);\r\n \t}\r\n });\r\n\r\n // @namespace Control.Zoom\r\n // @factory L.control.zoom(options: Control.Zoom options)\r\n // Creates a zoom control\r\n var zoom = function (options) {\r\n \treturn new Zoom(options);\r\n };\n\n /*\n * @class Control.Scale\n * @aka L.Control.Scale\n * @inherits Control\n *\n * A simple scale control that shows the scale of the current center of screen in metric (m/km) and imperial (mi/ft) systems. Extends `Control`.\n *\n * @example\n *\n * ```js\n * L.control.scale().addTo(map);\n * ```\n */\n\n var Scale = Control.extend({\n \t// @section\n \t// @aka Control.Scale options\n \toptions: {\n \t\tposition: 'bottomleft',\n\n \t\t// @option maxWidth: Number = 100\n \t\t// Maximum width of the control in pixels. The width is set dynamically to show round values (e.g. 100, 200, 500).\n \t\tmaxWidth: 100,\n\n \t\t// @option metric: Boolean = True\n \t\t// Whether to show the metric scale line (m/km).\n \t\tmetric: true,\n\n \t\t// @option imperial: Boolean = True\n \t\t// Whether to show the imperial scale line (mi/ft).\n \t\timperial: true\n\n \t\t// @option updateWhenIdle: Boolean = false\n \t\t// If `true`, the control is updated on [`moveend`](#map-moveend), otherwise it's always up-to-date (updated on [`move`](#map-move)).\n \t},\n\n \tonAdd: function (map) {\n \t\tvar className = 'leaflet-control-scale',\n \t\t container = create$1('div', className),\n \t\t options = this.options;\n\n \t\tthis._addScales(options, className + '-line', container);\n\n \t\tmap.on(options.updateWhenIdle ? 'moveend' : 'move', this._update, this);\n \t\tmap.whenReady(this._update, this);\n\n \t\treturn container;\n \t},\n\n \tonRemove: function (map) {\n \t\tmap.off(this.options.updateWhenIdle ? 'moveend' : 'move', this._update, this);\n \t},\n\n \t_addScales: function (options, className, container) {\n \t\tif (options.metric) {\n \t\t\tthis._mScale = create$1('div', className, container);\n \t\t}\n \t\tif (options.imperial) {\n \t\t\tthis._iScale = create$1('div', className, container);\n \t\t}\n \t},\n\n \t_update: function () {\n \t\tvar map = this._map,\n \t\t y = map.getSize().y / 2;\n\n \t\tvar maxMeters = map.distance(\n \t\t\tmap.containerPointToLatLng([0, y]),\n \t\t\tmap.containerPointToLatLng([this.options.maxWidth, y]));\n\n \t\tthis._updateScales(maxMeters);\n \t},\n\n \t_updateScales: function (maxMeters) {\n \t\tif (this.options.metric && maxMeters) {\n \t\t\tthis._updateMetric(maxMeters);\n \t\t}\n \t\tif (this.options.imperial && maxMeters) {\n \t\t\tthis._updateImperial(maxMeters);\n \t\t}\n \t},\n\n \t_updateMetric: function (maxMeters) {\n \t\tvar meters = this._getRoundNum(maxMeters),\n \t\t label = meters < 1000 ? meters + ' m' : (meters / 1000) + ' km';\n\n \t\tthis._updateScale(this._mScale, label, meters / maxMeters);\n \t},\n\n \t_updateImperial: function (maxMeters) {\n \t\tvar maxFeet = maxMeters * 3.2808399,\n \t\t maxMiles, miles, feet;\n\n \t\tif (maxFeet > 5280) {\n \t\t\tmaxMiles = maxFeet / 5280;\n \t\t\tmiles = this._getRoundNum(maxMiles);\n \t\t\tthis._updateScale(this._iScale, miles + ' mi', miles / maxMiles);\n\n \t\t} else {\n \t\t\tfeet = this._getRoundNum(maxFeet);\n \t\t\tthis._updateScale(this._iScale, feet + ' ft', feet / maxFeet);\n \t\t}\n \t},\n\n \t_updateScale: function (scale, text, ratio) {\n \t\tscale.style.width = Math.round(this.options.maxWidth * ratio) + 'px';\n \t\tscale.innerHTML = text;\n \t},\n\n \t_getRoundNum: function (num) {\n \t\tvar pow10 = Math.pow(10, (Math.floor(num) + '').length - 1),\n \t\t d = num / pow10;\n\n \t\td = d >= 10 ? 10 :\n \t\t d >= 5 ? 5 :\n \t\t d >= 3 ? 3 :\n \t\t d >= 2 ? 2 : 1;\n\n \t\treturn pow10 * d;\n \t}\n });\n\n\n // @factory L.control.scale(options?: Control.Scale options)\n // Creates an scale control with the given options.\n var scale = function (options) {\n \treturn new Scale(options);\n };\n\n /*\r\n * @class Control.Attribution\r\n * @aka L.Control.Attribution\r\n * @inherits Control\r\n *\r\n * The attribution control allows you to display attribution data in a small text box on a map. It is put on the map by default unless you set its [`attributionControl` option](#map-attributioncontrol) to `false`, and it fetches attribution texts from layers with the [`getAttribution` method](#layer-getattribution) automatically. Extends Control.\r\n */\r\n\r\n var Attribution = Control.extend({\r\n \t// @section\r\n \t// @aka Control.Attribution options\r\n \toptions: {\r\n \t\tposition: 'bottomright',\r\n\r\n \t\t// @option prefix: String = 'Leaflet'\r\n \t\t// The HTML text shown before the attributions. Pass `false` to disable.\r\n \t\tprefix: 'Leaflet'\r\n \t},\r\n\r\n \tinitialize: function (options) {\r\n \t\tsetOptions(this, options);\r\n\r\n \t\tthis._attributions = {};\r\n \t},\r\n\r\n \tonAdd: function (map) {\r\n \t\tmap.attributionControl = this;\r\n \t\tthis._container = create$1('div', 'leaflet-control-attribution');\r\n \t\tdisableClickPropagation(this._container);\r\n\r\n \t\t// TODO ugly, refactor\r\n \t\tfor (var i in map._layers) {\r\n \t\t\tif (map._layers[i].getAttribution) {\r\n \t\t\t\tthis.addAttribution(map._layers[i].getAttribution());\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\tthis._update();\r\n\r\n \t\treturn this._container;\r\n \t},\r\n\r\n \t// @method setPrefix(prefix: String): this\r\n \t// Sets the text before the attributions.\r\n \tsetPrefix: function (prefix) {\r\n \t\tthis.options.prefix = prefix;\r\n \t\tthis._update();\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method addAttribution(text: String): this\r\n \t// Adds an attribution text (e.g. `'Vector data © Mapbox'`).\r\n \taddAttribution: function (text) {\r\n \t\tif (!text) { return this; }\r\n\r\n \t\tif (!this._attributions[text]) {\r\n \t\t\tthis._attributions[text] = 0;\r\n \t\t}\r\n \t\tthis._attributions[text]++;\r\n\r\n \t\tthis._update();\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method removeAttribution(text: String): this\r\n \t// Removes an attribution text.\r\n \tremoveAttribution: function (text) {\r\n \t\tif (!text) { return this; }\r\n\r\n \t\tif (this._attributions[text]) {\r\n \t\t\tthis._attributions[text]--;\r\n \t\t\tthis._update();\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t_update: function () {\r\n \t\tif (!this._map) { return; }\r\n\r\n \t\tvar attribs = [];\r\n\r\n \t\tfor (var i in this._attributions) {\r\n \t\t\tif (this._attributions[i]) {\r\n \t\t\t\tattribs.push(i);\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\tvar prefixAndAttribs = [];\r\n\r\n \t\tif (this.options.prefix) {\r\n \t\t\tprefixAndAttribs.push(this.options.prefix);\r\n \t\t}\r\n \t\tif (attribs.length) {\r\n \t\t\tprefixAndAttribs.push(attribs.join(', '));\r\n \t\t}\r\n\r\n \t\tthis._container.innerHTML = prefixAndAttribs.join(' | ');\r\n \t}\r\n });\r\n\r\n // @namespace Map\r\n // @section Control options\r\n // @option attributionControl: Boolean = true\r\n // Whether a [attribution control](#control-attribution) is added to the map by default.\r\n Map.mergeOptions({\r\n \tattributionControl: true\r\n });\r\n\r\n Map.addInitHook(function () {\r\n \tif (this.options.attributionControl) {\r\n \t\tnew Attribution().addTo(this);\r\n \t}\r\n });\r\n\r\n // @namespace Control.Attribution\r\n // @factory L.control.attribution(options: Control.Attribution options)\r\n // Creates an attribution control.\r\n var attribution = function (options) {\r\n \treturn new Attribution(options);\r\n };\n\n Control.Layers = Layers;\n Control.Zoom = Zoom;\n Control.Scale = Scale;\n Control.Attribution = Attribution;\n\n control.layers = layers;\n control.zoom = zoom;\n control.scale = scale;\n control.attribution = attribution;\n\n /*\n \tL.Handler is a base class for handler classes that are used internally to inject\n \tinteraction features like dragging to classes like Map and Marker.\n */\n\n // @class Handler\n // @aka L.Handler\n // Abstract class for map interaction handlers\n\n var Handler = Class.extend({\n \tinitialize: function (map) {\n \t\tthis._map = map;\n \t},\n\n \t// @method enable(): this\n \t// Enables the handler\n \tenable: function () {\n \t\tif (this._enabled) { return this; }\n\n \t\tthis._enabled = true;\n \t\tthis.addHooks();\n \t\treturn this;\n \t},\n\n \t// @method disable(): this\n \t// Disables the handler\n \tdisable: function () {\n \t\tif (!this._enabled) { return this; }\n\n \t\tthis._enabled = false;\n \t\tthis.removeHooks();\n \t\treturn this;\n \t},\n\n \t// @method enabled(): Boolean\n \t// Returns `true` if the handler is enabled\n \tenabled: function () {\n \t\treturn !!this._enabled;\n \t}\n\n \t// @section Extension methods\n \t// Classes inheriting from `Handler` must implement the two following methods:\n \t// @method addHooks()\n \t// Called when the handler is enabled, should add event hooks.\n \t// @method removeHooks()\n \t// Called when the handler is disabled, should remove the event hooks added previously.\n });\n\n // @section There is static function which can be called without instantiating L.Handler:\n // @function addTo(map: Map, name: String): this\n // Adds a new Handler to the given map with the given name.\n Handler.addTo = function (map, name) {\n \tmap.addHandler(name, this);\n \treturn this;\n };\n\n var Mixin = {Events: Events};\n\n /*\r\n * @class Draggable\r\n * @aka L.Draggable\r\n * @inherits Evented\r\n *\r\n * A class for making DOM elements draggable (including touch support).\r\n * Used internally for map and marker dragging. Only works for elements\r\n * that were positioned with [`L.DomUtil.setPosition`](#domutil-setposition).\r\n *\r\n * @example\r\n * ```js\r\n * var draggable = new L.Draggable(elementToDrag);\r\n * draggable.enable();\r\n * ```\r\n */\r\n\r\n var START = touch ? 'touchstart mousedown' : 'mousedown';\r\n var END = {\r\n \tmousedown: 'mouseup',\r\n \ttouchstart: 'touchend',\r\n \tpointerdown: 'touchend',\r\n \tMSPointerDown: 'touchend'\r\n };\r\n var MOVE = {\r\n \tmousedown: 'mousemove',\r\n \ttouchstart: 'touchmove',\r\n \tpointerdown: 'touchmove',\r\n \tMSPointerDown: 'touchmove'\r\n };\r\n\r\n\r\n var Draggable = Evented.extend({\r\n\r\n \toptions: {\r\n \t\t// @section\r\n \t\t// @aka Draggable options\r\n \t\t// @option clickTolerance: Number = 3\r\n \t\t// The max number of pixels a user can shift the mouse pointer during a click\r\n \t\t// for it to be considered a valid click (as opposed to a mouse drag).\r\n \t\tclickTolerance: 3\r\n \t},\r\n\r\n \t// @constructor L.Draggable(el: HTMLElement, dragHandle?: HTMLElement, preventOutline?: Boolean, options?: Draggable options)\r\n \t// Creates a `Draggable` object for moving `el` when you start dragging the `dragHandle` element (equals `el` itself by default).\r\n \tinitialize: function (element, dragStartTarget, preventOutline$$1, options) {\r\n \t\tsetOptions(this, options);\r\n\r\n \t\tthis._element = element;\r\n \t\tthis._dragStartTarget = dragStartTarget || element;\r\n \t\tthis._preventOutline = preventOutline$$1;\r\n \t},\r\n\r\n \t// @method enable()\r\n \t// Enables the dragging ability\r\n \tenable: function () {\r\n \t\tif (this._enabled) { return; }\r\n\r\n \t\ton(this._dragStartTarget, START, this._onDown, this);\r\n\r\n \t\tthis._enabled = true;\r\n \t},\r\n\r\n \t// @method disable()\r\n \t// Disables the dragging ability\r\n \tdisable: function () {\r\n \t\tif (!this._enabled) { return; }\r\n\r\n \t\t// If we're currently dragging this draggable,\r\n \t\t// disabling it counts as first ending the drag.\r\n \t\tif (Draggable._dragging === this) {\r\n \t\t\tthis.finishDrag();\r\n \t\t}\r\n\r\n \t\toff(this._dragStartTarget, START, this._onDown, this);\r\n\r\n \t\tthis._enabled = false;\r\n \t\tthis._moved = false;\r\n \t},\r\n\r\n \t_onDown: function (e) {\r\n \t\t// Ignore simulated events, since we handle both touch and\r\n \t\t// mouse explicitly; otherwise we risk getting duplicates of\r\n \t\t// touch events, see #4315.\r\n \t\t// Also ignore the event if disabled; this happens in IE11\r\n \t\t// under some circumstances, see #3666.\r\n \t\tif (e._simulated || !this._enabled) { return; }\r\n\r\n \t\tthis._moved = false;\r\n\r\n \t\tif (hasClass(this._element, 'leaflet-zoom-anim')) { return; }\r\n\r\n \t\tif (Draggable._dragging || e.shiftKey || ((e.which !== 1) && (e.button !== 1) && !e.touches)) { return; }\r\n \t\tDraggable._dragging = this; // Prevent dragging multiple objects at once.\r\n\r\n \t\tif (this._preventOutline) {\r\n \t\t\tpreventOutline(this._element);\r\n \t\t}\r\n\r\n \t\tdisableImageDrag();\r\n \t\tdisableTextSelection();\r\n\r\n \t\tif (this._moving) { return; }\r\n\r\n \t\t// @event down: Event\r\n \t\t// Fired when a drag is about to start.\r\n \t\tthis.fire('down');\r\n\r\n \t\tvar first = e.touches ? e.touches[0] : e,\r\n \t\t sizedParent = getSizedParentNode(this._element);\r\n\r\n \t\tthis._startPoint = new Point(first.clientX, first.clientY);\r\n\r\n \t\t// Cache the scale, so that we can continuously compensate for it during drag (_onMove).\r\n \t\tthis._parentScale = getScale(sizedParent);\r\n\r\n \t\ton(document, MOVE[e.type], this._onMove, this);\r\n \t\ton(document, END[e.type], this._onUp, this);\r\n \t},\r\n\r\n \t_onMove: function (e) {\r\n \t\t// Ignore simulated events, since we handle both touch and\r\n \t\t// mouse explicitly; otherwise we risk getting duplicates of\r\n \t\t// touch events, see #4315.\r\n \t\t// Also ignore the event if disabled; this happens in IE11\r\n \t\t// under some circumstances, see #3666.\r\n \t\tif (e._simulated || !this._enabled) { return; }\r\n\r\n \t\tif (e.touches && e.touches.length > 1) {\r\n \t\t\tthis._moved = true;\r\n \t\t\treturn;\r\n \t\t}\r\n\r\n \t\tvar first = (e.touches && e.touches.length === 1 ? e.touches[0] : e),\r\n \t\t offset = new Point(first.clientX, first.clientY)._subtract(this._startPoint);\r\n\r\n \t\tif (!offset.x && !offset.y) { return; }\r\n \t\tif (Math.abs(offset.x) + Math.abs(offset.y) < this.options.clickTolerance) { return; }\r\n\r\n \t\t// We assume that the parent container's position, border and scale do not change for the duration of the drag.\r\n \t\t// Therefore there is no need to account for the position and border (they are eliminated by the subtraction)\r\n \t\t// and we can use the cached value for the scale.\r\n \t\toffset.x /= this._parentScale.x;\r\n \t\toffset.y /= this._parentScale.y;\r\n\r\n \t\tpreventDefault(e);\r\n\r\n \t\tif (!this._moved) {\r\n \t\t\t// @event dragstart: Event\r\n \t\t\t// Fired when a drag starts\r\n \t\t\tthis.fire('dragstart');\r\n\r\n \t\t\tthis._moved = true;\r\n \t\t\tthis._startPos = getPosition(this._element).subtract(offset);\r\n\r\n \t\t\taddClass(document.body, 'leaflet-dragging');\r\n\r\n \t\t\tthis._lastTarget = e.target || e.srcElement;\r\n \t\t\t// IE and Edge do not give the element, so fetch it\r\n \t\t\t// if necessary\r\n \t\t\tif (window.SVGElementInstance && this._lastTarget instanceof window.SVGElementInstance) {\r\n \t\t\t\tthis._lastTarget = this._lastTarget.correspondingUseElement;\r\n \t\t\t}\r\n \t\t\taddClass(this._lastTarget, 'leaflet-drag-target');\r\n \t\t}\r\n\r\n \t\tthis._newPos = this._startPos.add(offset);\r\n \t\tthis._moving = true;\r\n\r\n \t\tcancelAnimFrame(this._animRequest);\r\n \t\tthis._lastEvent = e;\r\n \t\tthis._animRequest = requestAnimFrame(this._updatePosition, this, true);\r\n \t},\r\n\r\n \t_updatePosition: function () {\r\n \t\tvar e = {originalEvent: this._lastEvent};\r\n\r\n \t\t// @event predrag: Event\r\n \t\t// Fired continuously during dragging *before* each corresponding\r\n \t\t// update of the element's position.\r\n \t\tthis.fire('predrag', e);\r\n \t\tsetPosition(this._element, this._newPos);\r\n\r\n \t\t// @event drag: Event\r\n \t\t// Fired continuously during dragging.\r\n \t\tthis.fire('drag', e);\r\n \t},\r\n\r\n \t_onUp: function (e) {\r\n \t\t// Ignore simulated events, since we handle both touch and\r\n \t\t// mouse explicitly; otherwise we risk getting duplicates of\r\n \t\t// touch events, see #4315.\r\n \t\t// Also ignore the event if disabled; this happens in IE11\r\n \t\t// under some circumstances, see #3666.\r\n \t\tif (e._simulated || !this._enabled) { return; }\r\n \t\tthis.finishDrag();\r\n \t},\r\n\r\n \tfinishDrag: function () {\r\n \t\tremoveClass(document.body, 'leaflet-dragging');\r\n\r\n \t\tif (this._lastTarget) {\r\n \t\t\tremoveClass(this._lastTarget, 'leaflet-drag-target');\r\n \t\t\tthis._lastTarget = null;\r\n \t\t}\r\n\r\n \t\tfor (var i in MOVE) {\r\n \t\t\toff(document, MOVE[i], this._onMove, this);\r\n \t\t\toff(document, END[i], this._onUp, this);\r\n \t\t}\r\n\r\n \t\tenableImageDrag();\r\n \t\tenableTextSelection();\r\n\r\n \t\tif (this._moved && this._moving) {\r\n \t\t\t// ensure drag is not fired after dragend\r\n \t\t\tcancelAnimFrame(this._animRequest);\r\n\r\n \t\t\t// @event dragend: DragEndEvent\r\n \t\t\t// Fired when the drag ends.\r\n \t\t\tthis.fire('dragend', {\r\n \t\t\t\tdistance: this._newPos.distanceTo(this._startPos)\r\n \t\t\t});\r\n \t\t}\r\n\r\n \t\tthis._moving = false;\r\n \t\tDraggable._dragging = false;\r\n \t}\r\n\r\n });\n\n /*\r\n * @namespace LineUtil\r\n *\r\n * Various utility functions for polyline points processing, used by Leaflet internally to make polylines lightning-fast.\r\n */\r\n\r\n // Simplify polyline with vertex reduction and Douglas-Peucker simplification.\r\n // Improves rendering performance dramatically by lessening the number of points to draw.\r\n\r\n // @function simplify(points: Point[], tolerance: Number): Point[]\r\n // Dramatically reduces the number of points in a polyline while retaining\r\n // its shape and returns a new array of simplified points, using the\r\n // [Douglas-Peucker algorithm](http://en.wikipedia.org/wiki/Douglas-Peucker_algorithm).\r\n // Used for a huge performance boost when processing/displaying Leaflet polylines for\r\n // each zoom level and also reducing visual noise. tolerance affects the amount of\r\n // simplification (lesser value means higher quality but slower and with more points).\r\n // Also released as a separated micro-library [Simplify.js](http://mourner.github.com/simplify-js/).\r\n function simplify(points, tolerance) {\r\n \tif (!tolerance || !points.length) {\r\n \t\treturn points.slice();\r\n \t}\r\n\r\n \tvar sqTolerance = tolerance * tolerance;\r\n\r\n \t // stage 1: vertex reduction\r\n \t points = _reducePoints(points, sqTolerance);\r\n\r\n \t // stage 2: Douglas-Peucker simplification\r\n \t points = _simplifyDP(points, sqTolerance);\r\n\r\n \treturn points;\r\n }\r\n\r\n // @function pointToSegmentDistance(p: Point, p1: Point, p2: Point): Number\r\n // Returns the distance between point `p` and segment `p1` to `p2`.\r\n function pointToSegmentDistance(p, p1, p2) {\r\n \treturn Math.sqrt(_sqClosestPointOnSegment(p, p1, p2, true));\r\n }\r\n\r\n // @function closestPointOnSegment(p: Point, p1: Point, p2: Point): Number\r\n // Returns the closest point from a point `p` on a segment `p1` to `p2`.\r\n function closestPointOnSegment(p, p1, p2) {\r\n \treturn _sqClosestPointOnSegment(p, p1, p2);\r\n }\r\n\r\n // Douglas-Peucker simplification, see http://en.wikipedia.org/wiki/Douglas-Peucker_algorithm\r\n function _simplifyDP(points, sqTolerance) {\r\n\r\n \tvar len = points.length,\r\n \t ArrayConstructor = typeof Uint8Array !== undefined + '' ? Uint8Array : Array,\r\n \t markers = new ArrayConstructor(len);\r\n\r\n \t markers[0] = markers[len - 1] = 1;\r\n\r\n \t_simplifyDPStep(points, markers, sqTolerance, 0, len - 1);\r\n\r\n \tvar i,\r\n \t newPoints = [];\r\n\r\n \tfor (i = 0; i < len; i++) {\r\n \t\tif (markers[i]) {\r\n \t\t\tnewPoints.push(points[i]);\r\n \t\t}\r\n \t}\r\n\r\n \treturn newPoints;\r\n }\r\n\r\n function _simplifyDPStep(points, markers, sqTolerance, first, last) {\r\n\r\n \tvar maxSqDist = 0,\r\n \tindex, i, sqDist;\r\n\r\n \tfor (i = first + 1; i <= last - 1; i++) {\r\n \t\tsqDist = _sqClosestPointOnSegment(points[i], points[first], points[last], true);\r\n\r\n \t\tif (sqDist > maxSqDist) {\r\n \t\t\tindex = i;\r\n \t\t\tmaxSqDist = sqDist;\r\n \t\t}\r\n \t}\r\n\r\n \tif (maxSqDist > sqTolerance) {\r\n \t\tmarkers[index] = 1;\r\n\r\n \t\t_simplifyDPStep(points, markers, sqTolerance, first, index);\r\n \t\t_simplifyDPStep(points, markers, sqTolerance, index, last);\r\n \t}\r\n }\r\n\r\n // reduce points that are too close to each other to a single point\r\n function _reducePoints(points, sqTolerance) {\r\n \tvar reducedPoints = [points[0]];\r\n\r\n \tfor (var i = 1, prev = 0, len = points.length; i < len; i++) {\r\n \t\tif (_sqDist(points[i], points[prev]) > sqTolerance) {\r\n \t\t\treducedPoints.push(points[i]);\r\n \t\t\tprev = i;\r\n \t\t}\r\n \t}\r\n \tif (prev < len - 1) {\r\n \t\treducedPoints.push(points[len - 1]);\r\n \t}\r\n \treturn reducedPoints;\r\n }\r\n\r\n var _lastCode;\r\n\r\n // @function clipSegment(a: Point, b: Point, bounds: Bounds, useLastCode?: Boolean, round?: Boolean): Point[]|Boolean\r\n // Clips the segment a to b by rectangular bounds with the\r\n // [Cohen-Sutherland algorithm](https://en.wikipedia.org/wiki/Cohen%E2%80%93Sutherland_algorithm)\r\n // (modifying the segment points directly!). Used by Leaflet to only show polyline\r\n // points that are on the screen or near, increasing performance.\r\n function clipSegment(a, b, bounds, useLastCode, round) {\r\n \tvar codeA = useLastCode ? _lastCode : _getBitCode(a, bounds),\r\n \t codeB = _getBitCode(b, bounds),\r\n\r\n \t codeOut, p, newCode;\r\n\r\n \t // save 2nd code to avoid calculating it on the next segment\r\n \t _lastCode = codeB;\r\n\r\n \twhile (true) {\r\n \t\t// if a,b is inside the clip window (trivial accept)\r\n \t\tif (!(codeA | codeB)) {\r\n \t\t\treturn [a, b];\r\n \t\t}\r\n\r\n \t\t// if a,b is outside the clip window (trivial reject)\r\n \t\tif (codeA & codeB) {\r\n \t\t\treturn false;\r\n \t\t}\r\n\r\n \t\t// other cases\r\n \t\tcodeOut = codeA || codeB;\r\n \t\tp = _getEdgeIntersection(a, b, codeOut, bounds, round);\r\n \t\tnewCode = _getBitCode(p, bounds);\r\n\r\n \t\tif (codeOut === codeA) {\r\n \t\t\ta = p;\r\n \t\t\tcodeA = newCode;\r\n \t\t} else {\r\n \t\t\tb = p;\r\n \t\t\tcodeB = newCode;\r\n \t\t}\r\n \t}\r\n }\r\n\r\n function _getEdgeIntersection(a, b, code, bounds, round) {\r\n \tvar dx = b.x - a.x,\r\n \t dy = b.y - a.y,\r\n \t min = bounds.min,\r\n \t max = bounds.max,\r\n \t x, y;\r\n\r\n \tif (code & 8) { // top\r\n \t\tx = a.x + dx * (max.y - a.y) / dy;\r\n \t\ty = max.y;\r\n\r\n \t} else if (code & 4) { // bottom\r\n \t\tx = a.x + dx * (min.y - a.y) / dy;\r\n \t\ty = min.y;\r\n\r\n \t} else if (code & 2) { // right\r\n \t\tx = max.x;\r\n \t\ty = a.y + dy * (max.x - a.x) / dx;\r\n\r\n \t} else if (code & 1) { // left\r\n \t\tx = min.x;\r\n \t\ty = a.y + dy * (min.x - a.x) / dx;\r\n \t}\r\n\r\n \treturn new Point(x, y, round);\r\n }\r\n\r\n function _getBitCode(p, bounds) {\r\n \tvar code = 0;\r\n\r\n \tif (p.x < bounds.min.x) { // left\r\n \t\tcode |= 1;\r\n \t} else if (p.x > bounds.max.x) { // right\r\n \t\tcode |= 2;\r\n \t}\r\n\r\n \tif (p.y < bounds.min.y) { // bottom\r\n \t\tcode |= 4;\r\n \t} else if (p.y > bounds.max.y) { // top\r\n \t\tcode |= 8;\r\n \t}\r\n\r\n \treturn code;\r\n }\r\n\r\n // square distance (to avoid unnecessary Math.sqrt calls)\r\n function _sqDist(p1, p2) {\r\n \tvar dx = p2.x - p1.x,\r\n \t dy = p2.y - p1.y;\r\n \treturn dx * dx + dy * dy;\r\n }\r\n\r\n // return closest point on segment or distance to that point\r\n function _sqClosestPointOnSegment(p, p1, p2, sqDist) {\r\n \tvar x = p1.x,\r\n \t y = p1.y,\r\n \t dx = p2.x - x,\r\n \t dy = p2.y - y,\r\n \t dot = dx * dx + dy * dy,\r\n \t t;\r\n\r\n \tif (dot > 0) {\r\n \t\tt = ((p.x - x) * dx + (p.y - y) * dy) / dot;\r\n\r\n \t\tif (t > 1) {\r\n \t\t\tx = p2.x;\r\n \t\t\ty = p2.y;\r\n \t\t} else if (t > 0) {\r\n \t\t\tx += dx * t;\r\n \t\t\ty += dy * t;\r\n \t\t}\r\n \t}\r\n\r\n \tdx = p.x - x;\r\n \tdy = p.y - y;\r\n\r\n \treturn sqDist ? dx * dx + dy * dy : new Point(x, y);\r\n }\r\n\r\n\r\n // @function isFlat(latlngs: LatLng[]): Boolean\r\n // Returns true if `latlngs` is a flat array, false is nested.\r\n function isFlat(latlngs) {\r\n \treturn !isArray(latlngs[0]) || (typeof latlngs[0][0] !== 'object' && typeof latlngs[0][0] !== 'undefined');\r\n }\r\n\r\n function _flat(latlngs) {\r\n \tconsole.warn('Deprecated use of _flat, please use L.LineUtil.isFlat instead.');\r\n \treturn isFlat(latlngs);\r\n }\n\n var LineUtil = ({\n simplify: simplify,\n pointToSegmentDistance: pointToSegmentDistance,\n closestPointOnSegment: closestPointOnSegment,\n clipSegment: clipSegment,\n _getEdgeIntersection: _getEdgeIntersection,\n _getBitCode: _getBitCode,\n _sqClosestPointOnSegment: _sqClosestPointOnSegment,\n isFlat: isFlat,\n _flat: _flat\n });\n\n /*\r\n * @namespace PolyUtil\r\n * Various utility functions for polygon geometries.\r\n */\r\n\r\n /* @function clipPolygon(points: Point[], bounds: Bounds, round?: Boolean): Point[]\r\n * Clips the polygon geometry defined by the given `points` by the given bounds (using the [Sutherland-Hodgman algorithm](https://en.wikipedia.org/wiki/Sutherland%E2%80%93Hodgman_algorithm)).\r\n * Used by Leaflet to only show polygon points that are on the screen or near, increasing\r\n * performance. Note that polygon points needs different algorithm for clipping\r\n * than polyline, so there's a separate method for it.\r\n */\r\n function clipPolygon(points, bounds, round) {\r\n \tvar clippedPoints,\r\n \t edges = [1, 4, 2, 8],\r\n \t i, j, k,\r\n \t a, b,\r\n \t len, edge, p;\r\n\r\n \tfor (i = 0, len = points.length; i < len; i++) {\r\n \t\tpoints[i]._code = _getBitCode(points[i], bounds);\r\n \t}\r\n\r\n \t// for each edge (left, bottom, right, top)\r\n \tfor (k = 0; k < 4; k++) {\r\n \t\tedge = edges[k];\r\n \t\tclippedPoints = [];\r\n\r\n \t\tfor (i = 0, len = points.length, j = len - 1; i < len; j = i++) {\r\n \t\t\ta = points[i];\r\n \t\t\tb = points[j];\r\n\r\n \t\t\t// if a is inside the clip window\r\n \t\t\tif (!(a._code & edge)) {\r\n \t\t\t\t// if b is outside the clip window (a->b goes out of screen)\r\n \t\t\t\tif (b._code & edge) {\r\n \t\t\t\t\tp = _getEdgeIntersection(b, a, edge, bounds, round);\r\n \t\t\t\t\tp._code = _getBitCode(p, bounds);\r\n \t\t\t\t\tclippedPoints.push(p);\r\n \t\t\t\t}\r\n \t\t\t\tclippedPoints.push(a);\r\n\r\n \t\t\t// else if b is inside the clip window (a->b enters the screen)\r\n \t\t\t} else if (!(b._code & edge)) {\r\n \t\t\t\tp = _getEdgeIntersection(b, a, edge, bounds, round);\r\n \t\t\t\tp._code = _getBitCode(p, bounds);\r\n \t\t\t\tclippedPoints.push(p);\r\n \t\t\t}\r\n \t\t}\r\n \t\tpoints = clippedPoints;\r\n \t}\r\n\r\n \treturn points;\r\n }\n\n var PolyUtil = ({\n clipPolygon: clipPolygon\n });\n\n /*\r\n * @namespace Projection\r\n * @section\r\n * Leaflet comes with a set of already defined Projections out of the box:\r\n *\r\n * @projection L.Projection.LonLat\r\n *\r\n * Equirectangular, or Plate Carree projection — the most simple projection,\r\n * mostly used by GIS enthusiasts. Directly maps `x` as longitude, and `y` as\r\n * latitude. Also suitable for flat worlds, e.g. game maps. Used by the\r\n * `EPSG:4326` and `Simple` CRS.\r\n */\r\n\r\n var LonLat = {\r\n \tproject: function (latlng) {\r\n \t\treturn new Point(latlng.lng, latlng.lat);\r\n \t},\r\n\r\n \tunproject: function (point) {\r\n \t\treturn new LatLng(point.y, point.x);\r\n \t},\r\n\r\n \tbounds: new Bounds([-180, -90], [180, 90])\r\n };\n\n /*\r\n * @namespace Projection\r\n * @projection L.Projection.Mercator\r\n *\r\n * Elliptical Mercator projection — more complex than Spherical Mercator. Assumes that Earth is an ellipsoid. Used by the EPSG:3395 CRS.\r\n */\r\n\r\n var Mercator = {\r\n \tR: 6378137,\r\n \tR_MINOR: 6356752.314245179,\r\n\r\n \tbounds: new Bounds([-20037508.34279, -15496570.73972], [20037508.34279, 18764656.23138]),\r\n\r\n \tproject: function (latlng) {\r\n \t\tvar d = Math.PI / 180,\r\n \t\t r = this.R,\r\n \t\t y = latlng.lat * d,\r\n \t\t tmp = this.R_MINOR / r,\r\n \t\t e = Math.sqrt(1 - tmp * tmp),\r\n \t\t con = e * Math.sin(y);\r\n\r\n \t\tvar ts = Math.tan(Math.PI / 4 - y / 2) / Math.pow((1 - con) / (1 + con), e / 2);\r\n \t\ty = -r * Math.log(Math.max(ts, 1E-10));\r\n\r\n \t\treturn new Point(latlng.lng * d * r, y);\r\n \t},\r\n\r\n \tunproject: function (point) {\r\n \t\tvar d = 180 / Math.PI,\r\n \t\t r = this.R,\r\n \t\t tmp = this.R_MINOR / r,\r\n \t\t e = Math.sqrt(1 - tmp * tmp),\r\n \t\t ts = Math.exp(-point.y / r),\r\n \t\t phi = Math.PI / 2 - 2 * Math.atan(ts);\r\n\r\n \t\tfor (var i = 0, dphi = 0.1, con; i < 15 && Math.abs(dphi) > 1e-7; i++) {\r\n \t\t\tcon = e * Math.sin(phi);\r\n \t\t\tcon = Math.pow((1 - con) / (1 + con), e / 2);\r\n \t\t\tdphi = Math.PI / 2 - 2 * Math.atan(ts * con) - phi;\r\n \t\t\tphi += dphi;\r\n \t\t}\r\n\r\n \t\treturn new LatLng(phi * d, point.x * d / r);\r\n \t}\r\n };\n\n /*\n * @class Projection\n\n * An object with methods for projecting geographical coordinates of the world onto\n * a flat surface (and back). See [Map projection](http://en.wikipedia.org/wiki/Map_projection).\n\n * @property bounds: Bounds\n * The bounds (specified in CRS units) where the projection is valid\n\n * @method project(latlng: LatLng): Point\n * Projects geographical coordinates into a 2D point.\n * Only accepts actual `L.LatLng` instances, not arrays.\n\n * @method unproject(point: Point): LatLng\n * The inverse of `project`. Projects a 2D point into a geographical location.\n * Only accepts actual `L.Point` instances, not arrays.\n\n * Note that the projection instances do not inherit from Leaflet's `Class` object,\n * and can't be instantiated. Also, new classes can't inherit from them,\n * and methods can't be added to them with the `include` function.\n\n */\n\n var index = ({\n LonLat: LonLat,\n Mercator: Mercator,\n SphericalMercator: SphericalMercator\n });\n\n /*\r\n * @namespace CRS\r\n * @crs L.CRS.EPSG3395\r\n *\r\n * Rarely used by some commercial tile providers. Uses Elliptical Mercator projection.\r\n */\r\n var EPSG3395 = extend({}, Earth, {\r\n \tcode: 'EPSG:3395',\r\n \tprojection: Mercator,\r\n\r\n \ttransformation: (function () {\r\n \t\tvar scale = 0.5 / (Math.PI * Mercator.R);\r\n \t\treturn toTransformation(scale, 0.5, -scale, 0.5);\r\n \t}())\r\n });\n\n /*\r\n * @namespace CRS\r\n * @crs L.CRS.EPSG4326\r\n *\r\n * A common CRS among GIS enthusiasts. Uses simple Equirectangular projection.\r\n *\r\n * Leaflet 1.0.x complies with the [TMS coordinate scheme for EPSG:4326](https://wiki.osgeo.org/wiki/Tile_Map_Service_Specification#global-geodetic),\r\n * which is a breaking change from 0.7.x behaviour. If you are using a `TileLayer`\r\n * with this CRS, ensure that there are two 256x256 pixel tiles covering the\r\n * whole earth at zoom level zero, and that the tile coordinate origin is (-180,+90),\r\n * or (-180,-90) for `TileLayer`s with [the `tms` option](#tilelayer-tms) set.\r\n */\r\n\r\n var EPSG4326 = extend({}, Earth, {\r\n \tcode: 'EPSG:4326',\r\n \tprojection: LonLat,\r\n \ttransformation: toTransformation(1 / 180, 1, -1 / 180, 0.5)\r\n });\n\n /*\n * @namespace CRS\n * @crs L.CRS.Simple\n *\n * A simple CRS that maps longitude and latitude into `x` and `y` directly.\n * May be used for maps of flat surfaces (e.g. game maps). Note that the `y`\n * axis should still be inverted (going from bottom to top). `distance()` returns\n * simple euclidean distance.\n */\n\n var Simple = extend({}, CRS, {\n \tprojection: LonLat,\n \ttransformation: toTransformation(1, 0, -1, 0),\n\n \tscale: function (zoom) {\n \t\treturn Math.pow(2, zoom);\n \t},\n\n \tzoom: function (scale) {\n \t\treturn Math.log(scale) / Math.LN2;\n \t},\n\n \tdistance: function (latlng1, latlng2) {\n \t\tvar dx = latlng2.lng - latlng1.lng,\n \t\t dy = latlng2.lat - latlng1.lat;\n\n \t\treturn Math.sqrt(dx * dx + dy * dy);\n \t},\n\n \tinfinite: true\n });\n\n CRS.Earth = Earth;\n CRS.EPSG3395 = EPSG3395;\n CRS.EPSG3857 = EPSG3857;\n CRS.EPSG900913 = EPSG900913;\n CRS.EPSG4326 = EPSG4326;\n CRS.Simple = Simple;\n\n /*\n * @class Layer\n * @inherits Evented\n * @aka L.Layer\n * @aka ILayer\n *\n * A set of methods from the Layer base class that all Leaflet layers use.\n * Inherits all methods, options and events from `L.Evented`.\n *\n * @example\n *\n * ```js\n * var layer = L.marker(latlng).addTo(map);\n * layer.addTo(map);\n * layer.remove();\n * ```\n *\n * @event add: Event\n * Fired after the layer is added to a map\n *\n * @event remove: Event\n * Fired after the layer is removed from a map\n */\n\n\n var Layer = Evented.extend({\n\n \t// Classes extending `L.Layer` will inherit the following options:\n \toptions: {\n \t\t// @option pane: String = 'overlayPane'\n \t\t// By default the layer will be added to the map's [overlay pane](#map-overlaypane). Overriding this option will cause the layer to be placed on another pane by default.\n \t\tpane: 'overlayPane',\n\n \t\t// @option attribution: String = null\n \t\t// String to be shown in the attribution control, e.g. \"© OpenStreetMap contributors\". It describes the layer data and is often a legal obligation towards copyright holders and tile providers.\n \t\tattribution: null,\n\n \t\tbubblingMouseEvents: true\n \t},\n\n \t/* @section\n \t * Classes extending `L.Layer` will inherit the following methods:\n \t *\n \t * @method addTo(map: Map|LayerGroup): this\n \t * Adds the layer to the given map or layer group.\n \t */\n \taddTo: function (map) {\n \t\tmap.addLayer(this);\n \t\treturn this;\n \t},\n\n \t// @method remove: this\n \t// Removes the layer from the map it is currently active on.\n \tremove: function () {\n \t\treturn this.removeFrom(this._map || this._mapToAdd);\n \t},\n\n \t// @method removeFrom(map: Map): this\n \t// Removes the layer from the given map\n \t//\n \t// @alternative\n \t// @method removeFrom(group: LayerGroup): this\n \t// Removes the layer from the given `LayerGroup`\n \tremoveFrom: function (obj) {\n \t\tif (obj) {\n \t\t\tobj.removeLayer(this);\n \t\t}\n \t\treturn this;\n \t},\n\n \t// @method getPane(name? : String): HTMLElement\n \t// Returns the `HTMLElement` representing the named pane on the map. If `name` is omitted, returns the pane for this layer.\n \tgetPane: function (name) {\n \t\treturn this._map.getPane(name ? (this.options[name] || name) : this.options.pane);\n \t},\n\n \taddInteractiveTarget: function (targetEl) {\n \t\tthis._map._targets[stamp(targetEl)] = this;\n \t\treturn this;\n \t},\n\n \tremoveInteractiveTarget: function (targetEl) {\n \t\tdelete this._map._targets[stamp(targetEl)];\n \t\treturn this;\n \t},\n\n \t// @method getAttribution: String\n \t// Used by the `attribution control`, returns the [attribution option](#gridlayer-attribution).\n \tgetAttribution: function () {\n \t\treturn this.options.attribution;\n \t},\n\n \t_layerAdd: function (e) {\n \t\tvar map = e.target;\n\n \t\t// check in case layer gets added and then removed before the map is ready\n \t\tif (!map.hasLayer(this)) { return; }\n\n \t\tthis._map = map;\n \t\tthis._zoomAnimated = map._zoomAnimated;\n\n \t\tif (this.getEvents) {\n \t\t\tvar events = this.getEvents();\n \t\t\tmap.on(events, this);\n \t\t\tthis.once('remove', function () {\n \t\t\t\tmap.off(events, this);\n \t\t\t}, this);\n \t\t}\n\n \t\tthis.onAdd(map);\n\n \t\tif (this.getAttribution && map.attributionControl) {\n \t\t\tmap.attributionControl.addAttribution(this.getAttribution());\n \t\t}\n\n \t\tthis.fire('add');\n \t\tmap.fire('layeradd', {layer: this});\n \t}\n });\n\n /* @section Extension methods\n * @uninheritable\n *\n * Every layer should extend from `L.Layer` and (re-)implement the following methods.\n *\n * @method onAdd(map: Map): this\n * Should contain code that creates DOM elements for the layer, adds them to `map panes` where they should belong and puts listeners on relevant map events. Called on [`map.addLayer(layer)`](#map-addlayer).\n *\n * @method onRemove(map: Map): this\n * Should contain all clean up code that removes the layer's elements from the DOM and removes listeners previously added in [`onAdd`](#layer-onadd). Called on [`map.removeLayer(layer)`](#map-removelayer).\n *\n * @method getEvents(): Object\n * This optional method should return an object like `{ viewreset: this._reset }` for [`addEventListener`](#evented-addeventlistener). The event handlers in this object will be automatically added and removed from the map with your layer.\n *\n * @method getAttribution(): String\n * This optional method should return a string containing HTML to be shown on the `Attribution control` whenever the layer is visible.\n *\n * @method beforeAdd(map: Map): this\n * Optional method. Called on [`map.addLayer(layer)`](#map-addlayer), before the layer is added to the map, before events are initialized, without waiting until the map is in a usable state. Use for early initialization only.\n */\n\n\n /* @namespace Map\n * @section Layer events\n *\n * @event layeradd: LayerEvent\n * Fired when a new layer is added to the map.\n *\n * @event layerremove: LayerEvent\n * Fired when some layer is removed from the map\n *\n * @section Methods for Layers and Controls\n */\n Map.include({\n \t// @method addLayer(layer: Layer): this\n \t// Adds the given layer to the map\n \taddLayer: function (layer) {\n \t\tif (!layer._layerAdd) {\n \t\t\tthrow new Error('The provided object is not a Layer.');\n \t\t}\n\n \t\tvar id = stamp(layer);\n \t\tif (this._layers[id]) { return this; }\n \t\tthis._layers[id] = layer;\n\n \t\tlayer._mapToAdd = this;\n\n \t\tif (layer.beforeAdd) {\n \t\t\tlayer.beforeAdd(this);\n \t\t}\n\n \t\tthis.whenReady(layer._layerAdd, layer);\n\n \t\treturn this;\n \t},\n\n \t// @method removeLayer(layer: Layer): this\n \t// Removes the given layer from the map.\n \tremoveLayer: function (layer) {\n \t\tvar id = stamp(layer);\n\n \t\tif (!this._layers[id]) { return this; }\n\n \t\tif (this._loaded) {\n \t\t\tlayer.onRemove(this);\n \t\t}\n\n \t\tif (layer.getAttribution && this.attributionControl) {\n \t\t\tthis.attributionControl.removeAttribution(layer.getAttribution());\n \t\t}\n\n \t\tdelete this._layers[id];\n\n \t\tif (this._loaded) {\n \t\t\tthis.fire('layerremove', {layer: layer});\n \t\t\tlayer.fire('remove');\n \t\t}\n\n \t\tlayer._map = layer._mapToAdd = null;\n\n \t\treturn this;\n \t},\n\n \t// @method hasLayer(layer: Layer): Boolean\n \t// Returns `true` if the given layer is currently added to the map\n \thasLayer: function (layer) {\n \t\treturn !!layer && (stamp(layer) in this._layers);\n \t},\n\n \t/* @method eachLayer(fn: Function, context?: Object): this\n \t * Iterates over the layers of the map, optionally specifying context of the iterator function.\n \t * ```\n \t * map.eachLayer(function(layer){\n \t * layer.bindPopup('Hello');\n \t * });\n \t * ```\n \t */\n \teachLayer: function (method, context) {\n \t\tfor (var i in this._layers) {\n \t\t\tmethod.call(context, this._layers[i]);\n \t\t}\n \t\treturn this;\n \t},\n\n \t_addLayers: function (layers) {\n \t\tlayers = layers ? (isArray(layers) ? layers : [layers]) : [];\n\n \t\tfor (var i = 0, len = layers.length; i < len; i++) {\n \t\t\tthis.addLayer(layers[i]);\n \t\t}\n \t},\n\n \t_addZoomLimit: function (layer) {\n \t\tif (isNaN(layer.options.maxZoom) || !isNaN(layer.options.minZoom)) {\n \t\t\tthis._zoomBoundLayers[stamp(layer)] = layer;\n \t\t\tthis._updateZoomLevels();\n \t\t}\n \t},\n\n \t_removeZoomLimit: function (layer) {\n \t\tvar id = stamp(layer);\n\n \t\tif (this._zoomBoundLayers[id]) {\n \t\t\tdelete this._zoomBoundLayers[id];\n \t\t\tthis._updateZoomLevels();\n \t\t}\n \t},\n\n \t_updateZoomLevels: function () {\n \t\tvar minZoom = Infinity,\n \t\t maxZoom = -Infinity,\n \t\t oldZoomSpan = this._getZoomSpan();\n\n \t\tfor (var i in this._zoomBoundLayers) {\n \t\t\tvar options = this._zoomBoundLayers[i].options;\n\n \t\t\tminZoom = options.minZoom === undefined ? minZoom : Math.min(minZoom, options.minZoom);\n \t\t\tmaxZoom = options.maxZoom === undefined ? maxZoom : Math.max(maxZoom, options.maxZoom);\n \t\t}\n\n \t\tthis._layersMaxZoom = maxZoom === -Infinity ? undefined : maxZoom;\n \t\tthis._layersMinZoom = minZoom === Infinity ? undefined : minZoom;\n\n \t\t// @section Map state change events\n \t\t// @event zoomlevelschange: Event\n \t\t// Fired when the number of zoomlevels on the map is changed due\n \t\t// to adding or removing a layer.\n \t\tif (oldZoomSpan !== this._getZoomSpan()) {\n \t\t\tthis.fire('zoomlevelschange');\n \t\t}\n\n \t\tif (this.options.maxZoom === undefined && this._layersMaxZoom && this.getZoom() > this._layersMaxZoom) {\n \t\t\tthis.setZoom(this._layersMaxZoom);\n \t\t}\n \t\tif (this.options.minZoom === undefined && this._layersMinZoom && this.getZoom() < this._layersMinZoom) {\n \t\t\tthis.setZoom(this._layersMinZoom);\n \t\t}\n \t}\n });\n\n /*\r\n * @class LayerGroup\r\n * @aka L.LayerGroup\r\n * @inherits Layer\r\n *\r\n * Used to group several layers and handle them as one. If you add it to the map,\r\n * any layers added or removed from the group will be added/removed on the map as\r\n * well. Extends `Layer`.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * L.layerGroup([marker1, marker2])\r\n * \t.addLayer(polyline)\r\n * \t.addTo(map);\r\n * ```\r\n */\r\n\r\n var LayerGroup = Layer.extend({\r\n\r\n \tinitialize: function (layers, options) {\r\n \t\tsetOptions(this, options);\r\n\r\n \t\tthis._layers = {};\r\n\r\n \t\tvar i, len;\r\n\r\n \t\tif (layers) {\r\n \t\t\tfor (i = 0, len = layers.length; i < len; i++) {\r\n \t\t\t\tthis.addLayer(layers[i]);\r\n \t\t\t}\r\n \t\t}\r\n \t},\r\n\r\n \t// @method addLayer(layer: Layer): this\r\n \t// Adds the given layer to the group.\r\n \taddLayer: function (layer) {\r\n \t\tvar id = this.getLayerId(layer);\r\n\r\n \t\tthis._layers[id] = layer;\r\n\r\n \t\tif (this._map) {\r\n \t\t\tthis._map.addLayer(layer);\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method removeLayer(layer: Layer): this\r\n \t// Removes the given layer from the group.\r\n \t// @alternative\r\n \t// @method removeLayer(id: Number): this\r\n \t// Removes the layer with the given internal ID from the group.\r\n \tremoveLayer: function (layer) {\r\n \t\tvar id = layer in this._layers ? layer : this.getLayerId(layer);\r\n\r\n \t\tif (this._map && this._layers[id]) {\r\n \t\t\tthis._map.removeLayer(this._layers[id]);\r\n \t\t}\r\n\r\n \t\tdelete this._layers[id];\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method hasLayer(layer: Layer): Boolean\r\n \t// Returns `true` if the given layer is currently added to the group.\r\n \t// @alternative\r\n \t// @method hasLayer(id: Number): Boolean\r\n \t// Returns `true` if the given internal ID is currently added to the group.\r\n \thasLayer: function (layer) {\r\n \t\tif (!layer) { return false; }\r\n \t\tvar layerId = typeof layer === 'number' ? layer : this.getLayerId(layer);\r\n \t\treturn layerId in this._layers;\r\n \t},\r\n\r\n \t// @method clearLayers(): this\r\n \t// Removes all the layers from the group.\r\n \tclearLayers: function () {\r\n \t\treturn this.eachLayer(this.removeLayer, this);\r\n \t},\r\n\r\n \t// @method invoke(methodName: String, …): this\r\n \t// Calls `methodName` on every layer contained in this group, passing any\r\n \t// additional parameters. Has no effect if the layers contained do not\r\n \t// implement `methodName`.\r\n \tinvoke: function (methodName) {\r\n \t\tvar args = Array.prototype.slice.call(arguments, 1),\r\n \t\t i, layer;\r\n\r\n \t\tfor (i in this._layers) {\r\n \t\t\tlayer = this._layers[i];\r\n\r\n \t\t\tif (layer[methodName]) {\r\n \t\t\t\tlayer[methodName].apply(layer, args);\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \tonAdd: function (map) {\r\n \t\tthis.eachLayer(map.addLayer, map);\r\n \t},\r\n\r\n \tonRemove: function (map) {\r\n \t\tthis.eachLayer(map.removeLayer, map);\r\n \t},\r\n\r\n \t// @method eachLayer(fn: Function, context?: Object): this\r\n \t// Iterates over the layers of the group, optionally specifying context of the iterator function.\r\n \t// ```js\r\n \t// group.eachLayer(function (layer) {\r\n \t// \tlayer.bindPopup('Hello');\r\n \t// });\r\n \t// ```\r\n \teachLayer: function (method, context) {\r\n \t\tfor (var i in this._layers) {\r\n \t\t\tmethod.call(context, this._layers[i]);\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method getLayer(id: Number): Layer\r\n \t// Returns the layer with the given internal ID.\r\n \tgetLayer: function (id) {\r\n \t\treturn this._layers[id];\r\n \t},\r\n\r\n \t// @method getLayers(): Layer[]\r\n \t// Returns an array of all the layers added to the group.\r\n \tgetLayers: function () {\r\n \t\tvar layers = [];\r\n \t\tthis.eachLayer(layers.push, layers);\r\n \t\treturn layers;\r\n \t},\r\n\r\n \t// @method setZIndex(zIndex: Number): this\r\n \t// Calls `setZIndex` on every layer contained in this group, passing the z-index.\r\n \tsetZIndex: function (zIndex) {\r\n \t\treturn this.invoke('setZIndex', zIndex);\r\n \t},\r\n\r\n \t// @method getLayerId(layer: Layer): Number\r\n \t// Returns the internal ID for a layer\r\n \tgetLayerId: function (layer) {\r\n \t\treturn stamp(layer);\r\n \t}\r\n });\r\n\r\n\r\n // @factory L.layerGroup(layers?: Layer[], options?: Object)\r\n // Create a layer group, optionally given an initial set of layers and an `options` object.\r\n var layerGroup = function (layers, options) {\r\n \treturn new LayerGroup(layers, options);\r\n };\n\n /*\r\n * @class FeatureGroup\r\n * @aka L.FeatureGroup\r\n * @inherits LayerGroup\r\n *\r\n * Extended `LayerGroup` that makes it easier to do the same thing to all its member layers:\r\n * * [`bindPopup`](#layer-bindpopup) binds a popup to all of the layers at once (likewise with [`bindTooltip`](#layer-bindtooltip))\r\n * * Events are propagated to the `FeatureGroup`, so if the group has an event\r\n * handler, it will handle events from any of the layers. This includes mouse events\r\n * and custom events.\r\n * * Has `layeradd` and `layerremove` events\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * L.featureGroup([marker1, marker2, polyline])\r\n * \t.bindPopup('Hello world!')\r\n * \t.on('click', function() { alert('Clicked on a member of the group!'); })\r\n * \t.addTo(map);\r\n * ```\r\n */\r\n\r\n var FeatureGroup = LayerGroup.extend({\r\n\r\n \taddLayer: function (layer) {\r\n \t\tif (this.hasLayer(layer)) {\r\n \t\t\treturn this;\r\n \t\t}\r\n\r\n \t\tlayer.addEventParent(this);\r\n\r\n \t\tLayerGroup.prototype.addLayer.call(this, layer);\r\n\r\n \t\t// @event layeradd: LayerEvent\r\n \t\t// Fired when a layer is added to this `FeatureGroup`\r\n \t\treturn this.fire('layeradd', {layer: layer});\r\n \t},\r\n\r\n \tremoveLayer: function (layer) {\r\n \t\tif (!this.hasLayer(layer)) {\r\n \t\t\treturn this;\r\n \t\t}\r\n \t\tif (layer in this._layers) {\r\n \t\t\tlayer = this._layers[layer];\r\n \t\t}\r\n\r\n \t\tlayer.removeEventParent(this);\r\n\r\n \t\tLayerGroup.prototype.removeLayer.call(this, layer);\r\n\r\n \t\t// @event layerremove: LayerEvent\r\n \t\t// Fired when a layer is removed from this `FeatureGroup`\r\n \t\treturn this.fire('layerremove', {layer: layer});\r\n \t},\r\n\r\n \t// @method setStyle(style: Path options): this\r\n \t// Sets the given path options to each layer of the group that has a `setStyle` method.\r\n \tsetStyle: function (style) {\r\n \t\treturn this.invoke('setStyle', style);\r\n \t},\r\n\r\n \t// @method bringToFront(): this\r\n \t// Brings the layer group to the top of all other layers\r\n \tbringToFront: function () {\r\n \t\treturn this.invoke('bringToFront');\r\n \t},\r\n\r\n \t// @method bringToBack(): this\r\n \t// Brings the layer group to the back of all other layers\r\n \tbringToBack: function () {\r\n \t\treturn this.invoke('bringToBack');\r\n \t},\r\n\r\n \t// @method getBounds(): LatLngBounds\r\n \t// Returns the LatLngBounds of the Feature Group (created from bounds and coordinates of its children).\r\n \tgetBounds: function () {\r\n \t\tvar bounds = new LatLngBounds();\r\n\r\n \t\tfor (var id in this._layers) {\r\n \t\t\tvar layer = this._layers[id];\r\n \t\t\tbounds.extend(layer.getBounds ? layer.getBounds() : layer.getLatLng());\r\n \t\t}\r\n \t\treturn bounds;\r\n \t}\r\n });\r\n\r\n // @factory L.featureGroup(layers?: Layer[], options?: Object)\r\n // Create a feature group, optionally given an initial set of layers and an `options` object.\r\n var featureGroup = function (layers, options) {\r\n \treturn new FeatureGroup(layers, options);\r\n };\n\n /*\r\n * @class Icon\r\n * @aka L.Icon\r\n *\r\n * Represents an icon to provide when creating a marker.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * var myIcon = L.icon({\r\n * iconUrl: 'my-icon.png',\r\n * iconRetinaUrl: 'my-icon@2x.png',\r\n * iconSize: [38, 95],\r\n * iconAnchor: [22, 94],\r\n * popupAnchor: [-3, -76],\r\n * shadowUrl: 'my-icon-shadow.png',\r\n * shadowRetinaUrl: 'my-icon-shadow@2x.png',\r\n * shadowSize: [68, 95],\r\n * shadowAnchor: [22, 94]\r\n * });\r\n *\r\n * L.marker([50.505, 30.57], {icon: myIcon}).addTo(map);\r\n * ```\r\n *\r\n * `L.Icon.Default` extends `L.Icon` and is the blue icon Leaflet uses for markers by default.\r\n *\r\n */\r\n\r\n var Icon = Class.extend({\r\n\r\n \t/* @section\r\n \t * @aka Icon options\r\n \t *\r\n \t * @option iconUrl: String = null\r\n \t * **(required)** The URL to the icon image (absolute or relative to your script path).\r\n \t *\r\n \t * @option iconRetinaUrl: String = null\r\n \t * The URL to a retina sized version of the icon image (absolute or relative to your\r\n \t * script path). Used for Retina screen devices.\r\n \t *\r\n \t * @option iconSize: Point = null\r\n \t * Size of the icon image in pixels.\r\n \t *\r\n \t * @option iconAnchor: Point = null\r\n \t * The coordinates of the \"tip\" of the icon (relative to its top left corner). The icon\r\n \t * will be aligned so that this point is at the marker's geographical location. Centered\r\n \t * by default if size is specified, also can be set in CSS with negative margins.\r\n \t *\r\n \t * @option popupAnchor: Point = [0, 0]\r\n \t * The coordinates of the point from which popups will \"open\", relative to the icon anchor.\r\n \t *\r\n \t * @option tooltipAnchor: Point = [0, 0]\r\n \t * The coordinates of the point from which tooltips will \"open\", relative to the icon anchor.\r\n \t *\r\n \t * @option shadowUrl: String = null\r\n \t * The URL to the icon shadow image. If not specified, no shadow image will be created.\r\n \t *\r\n \t * @option shadowRetinaUrl: String = null\r\n \t *\r\n \t * @option shadowSize: Point = null\r\n \t * Size of the shadow image in pixels.\r\n \t *\r\n \t * @option shadowAnchor: Point = null\r\n \t * The coordinates of the \"tip\" of the shadow (relative to its top left corner) (the same\r\n \t * as iconAnchor if not specified).\r\n \t *\r\n \t * @option className: String = ''\r\n \t * A custom class name to assign to both icon and shadow images. Empty by default.\r\n \t */\r\n\r\n \toptions: {\r\n \t\tpopupAnchor: [0, 0],\r\n \t\ttooltipAnchor: [0, 0]\r\n \t},\r\n\r\n \tinitialize: function (options) {\r\n \t\tsetOptions(this, options);\r\n \t},\r\n\r\n \t// @method createIcon(oldIcon?: HTMLElement): HTMLElement\r\n \t// Called internally when the icon has to be shown, returns a `` HTML element\r\n \t// styled according to the options.\r\n \tcreateIcon: function (oldIcon) {\r\n \t\treturn this._createIcon('icon', oldIcon);\r\n \t},\r\n\r\n \t// @method createShadow(oldIcon?: HTMLElement): HTMLElement\r\n \t// As `createIcon`, but for the shadow beneath it.\r\n \tcreateShadow: function (oldIcon) {\r\n \t\treturn this._createIcon('shadow', oldIcon);\r\n \t},\r\n\r\n \t_createIcon: function (name, oldIcon) {\r\n \t\tvar src = this._getIconUrl(name);\r\n\r\n \t\tif (!src) {\r\n \t\t\tif (name === 'icon') {\r\n \t\t\t\tthrow new Error('iconUrl not set in Icon options (see the docs).');\r\n \t\t\t}\r\n \t\t\treturn null;\r\n \t\t}\r\n\r\n \t\tvar img = this._createImg(src, oldIcon && oldIcon.tagName === 'IMG' ? oldIcon : null);\r\n \t\tthis._setIconStyles(img, name);\r\n\r\n \t\treturn img;\r\n \t},\r\n\r\n \t_setIconStyles: function (img, name) {\r\n \t\tvar options = this.options;\r\n \t\tvar sizeOption = options[name + 'Size'];\r\n\r\n \t\tif (typeof sizeOption === 'number') {\r\n \t\t\tsizeOption = [sizeOption, sizeOption];\r\n \t\t}\r\n\r\n \t\tvar size = toPoint(sizeOption),\r\n \t\t anchor = toPoint(name === 'shadow' && options.shadowAnchor || options.iconAnchor ||\r\n \t\t size && size.divideBy(2, true));\r\n\r\n \t\timg.className = 'leaflet-marker-' + name + ' ' + (options.className || '');\r\n\r\n \t\tif (anchor) {\r\n \t\t\timg.style.marginLeft = (-anchor.x) + 'px';\r\n \t\t\timg.style.marginTop = (-anchor.y) + 'px';\r\n \t\t}\r\n\r\n \t\tif (size) {\r\n \t\t\timg.style.width = size.x + 'px';\r\n \t\t\timg.style.height = size.y + 'px';\r\n \t\t}\r\n \t},\r\n\r\n \t_createImg: function (src, el) {\r\n \t\tel = el || document.createElement('img');\r\n \t\tel.src = src;\r\n \t\treturn el;\r\n \t},\r\n\r\n \t_getIconUrl: function (name) {\r\n \t\treturn retina && this.options[name + 'RetinaUrl'] || this.options[name + 'Url'];\r\n \t}\r\n });\r\n\r\n\r\n // @factory L.icon(options: Icon options)\r\n // Creates an icon instance with the given options.\r\n function icon(options) {\r\n \treturn new Icon(options);\r\n }\n\n /*\n * @miniclass Icon.Default (Icon)\n * @aka L.Icon.Default\n * @section\n *\n * A trivial subclass of `Icon`, represents the icon to use in `Marker`s when\n * no icon is specified. Points to the blue marker image distributed with Leaflet\n * releases.\n *\n * In order to customize the default icon, just change the properties of `L.Icon.Default.prototype.options`\n * (which is a set of `Icon options`).\n *\n * If you want to _completely_ replace the default icon, override the\n * `L.Marker.prototype.options.icon` with your own icon instead.\n */\n\n var IconDefault = Icon.extend({\n\n \toptions: {\n \t\ticonUrl: 'marker-icon.png',\n \t\ticonRetinaUrl: 'marker-icon-2x.png',\n \t\tshadowUrl: 'marker-shadow.png',\n \t\ticonSize: [25, 41],\n \t\ticonAnchor: [12, 41],\n \t\tpopupAnchor: [1, -34],\n \t\ttooltipAnchor: [16, -28],\n \t\tshadowSize: [41, 41]\n \t},\n\n \t_getIconUrl: function (name) {\n \t\tif (!IconDefault.imagePath) {\t// Deprecated, backwards-compatibility only\n \t\t\tIconDefault.imagePath = this._detectIconPath();\n \t\t}\n\n \t\t// @option imagePath: String\n \t\t// `Icon.Default` will try to auto-detect the location of the\n \t\t// blue icon images. If you are placing these images in a non-standard\n \t\t// way, set this option to point to the right path.\n \t\treturn (this.options.imagePath || IconDefault.imagePath) + Icon.prototype._getIconUrl.call(this, name);\n \t},\n\n \t_detectIconPath: function () {\n \t\tvar el = create$1('div', 'leaflet-default-icon-path', document.body);\n \t\tvar path = getStyle(el, 'background-image') ||\n \t\t getStyle(el, 'backgroundImage');\t// IE8\n\n \t\tdocument.body.removeChild(el);\n\n \t\tif (path === null || path.indexOf('url') !== 0) {\n \t\t\tpath = '';\n \t\t} else {\n \t\t\tpath = path.replace(/^url\\([\"']?/, '').replace(/marker-icon\\.png[\"']?\\)$/, '');\n \t\t}\n\n \t\treturn path;\n \t}\n });\n\n /*\n * L.Handler.MarkerDrag is used internally by L.Marker to make the markers draggable.\n */\n\n\n /* @namespace Marker\n * @section Interaction handlers\n *\n * Interaction handlers are properties of a marker instance that allow you to control interaction behavior in runtime, enabling or disabling certain features such as dragging (see `Handler` methods). Example:\n *\n * ```js\n * marker.dragging.disable();\n * ```\n *\n * @property dragging: Handler\n * Marker dragging handler (by both mouse and touch). Only valid when the marker is on the map (Otherwise set [`marker.options.draggable`](#marker-draggable)).\n */\n\n var MarkerDrag = Handler.extend({\n \tinitialize: function (marker) {\n \t\tthis._marker = marker;\n \t},\n\n \taddHooks: function () {\n \t\tvar icon = this._marker._icon;\n\n \t\tif (!this._draggable) {\n \t\t\tthis._draggable = new Draggable(icon, icon, true);\n \t\t}\n\n \t\tthis._draggable.on({\n \t\t\tdragstart: this._onDragStart,\n \t\t\tpredrag: this._onPreDrag,\n \t\t\tdrag: this._onDrag,\n \t\t\tdragend: this._onDragEnd\n \t\t}, this).enable();\n\n \t\taddClass(icon, 'leaflet-marker-draggable');\n \t},\n\n \tremoveHooks: function () {\n \t\tthis._draggable.off({\n \t\t\tdragstart: this._onDragStart,\n \t\t\tpredrag: this._onPreDrag,\n \t\t\tdrag: this._onDrag,\n \t\t\tdragend: this._onDragEnd\n \t\t}, this).disable();\n\n \t\tif (this._marker._icon) {\n \t\t\tremoveClass(this._marker._icon, 'leaflet-marker-draggable');\n \t\t}\n \t},\n\n \tmoved: function () {\n \t\treturn this._draggable && this._draggable._moved;\n \t},\n\n \t_adjustPan: function (e) {\n \t\tvar marker = this._marker,\n \t\t map = marker._map,\n \t\t speed = this._marker.options.autoPanSpeed,\n \t\t padding = this._marker.options.autoPanPadding,\n \t\t iconPos = getPosition(marker._icon),\n \t\t bounds = map.getPixelBounds(),\n \t\t origin = map.getPixelOrigin();\n\n \t\tvar panBounds = toBounds(\n \t\t\tbounds.min._subtract(origin).add(padding),\n \t\t\tbounds.max._subtract(origin).subtract(padding)\n \t\t);\n\n \t\tif (!panBounds.contains(iconPos)) {\n \t\t\t// Compute incremental movement\n \t\t\tvar movement = toPoint(\n \t\t\t\t(Math.max(panBounds.max.x, iconPos.x) - panBounds.max.x) / (bounds.max.x - panBounds.max.x) -\n \t\t\t\t(Math.min(panBounds.min.x, iconPos.x) - panBounds.min.x) / (bounds.min.x - panBounds.min.x),\n\n \t\t\t\t(Math.max(panBounds.max.y, iconPos.y) - panBounds.max.y) / (bounds.max.y - panBounds.max.y) -\n \t\t\t\t(Math.min(panBounds.min.y, iconPos.y) - panBounds.min.y) / (bounds.min.y - panBounds.min.y)\n \t\t\t).multiplyBy(speed);\n\n \t\t\tmap.panBy(movement, {animate: false});\n\n \t\t\tthis._draggable._newPos._add(movement);\n \t\t\tthis._draggable._startPos._add(movement);\n\n \t\t\tsetPosition(marker._icon, this._draggable._newPos);\n \t\t\tthis._onDrag(e);\n\n \t\t\tthis._panRequest = requestAnimFrame(this._adjustPan.bind(this, e));\n \t\t}\n \t},\n\n \t_onDragStart: function () {\n \t\t// @section Dragging events\n \t\t// @event dragstart: Event\n \t\t// Fired when the user starts dragging the marker.\n\n \t\t// @event movestart: Event\n \t\t// Fired when the marker starts moving (because of dragging).\n\n \t\tthis._oldLatLng = this._marker.getLatLng();\n\n \t\t// When using ES6 imports it could not be set when `Popup` was not imported as well\n \t\tthis._marker.closePopup && this._marker.closePopup();\n\n \t\tthis._marker\n \t\t\t.fire('movestart')\n \t\t\t.fire('dragstart');\n \t},\n\n \t_onPreDrag: function (e) {\n \t\tif (this._marker.options.autoPan) {\n \t\t\tcancelAnimFrame(this._panRequest);\n \t\t\tthis._panRequest = requestAnimFrame(this._adjustPan.bind(this, e));\n \t\t}\n \t},\n\n \t_onDrag: function (e) {\n \t\tvar marker = this._marker,\n \t\t shadow = marker._shadow,\n \t\t iconPos = getPosition(marker._icon),\n \t\t latlng = marker._map.layerPointToLatLng(iconPos);\n\n \t\t// update shadow position\n \t\tif (shadow) {\n \t\t\tsetPosition(shadow, iconPos);\n \t\t}\n\n \t\tmarker._latlng = latlng;\n \t\te.latlng = latlng;\n \t\te.oldLatLng = this._oldLatLng;\n\n \t\t// @event drag: Event\n \t\t// Fired repeatedly while the user drags the marker.\n \t\tmarker\n \t\t .fire('move', e)\n \t\t .fire('drag', e);\n \t},\n\n \t_onDragEnd: function (e) {\n \t\t// @event dragend: DragEndEvent\n \t\t// Fired when the user stops dragging the marker.\n\n \t\t cancelAnimFrame(this._panRequest);\n\n \t\t// @event moveend: Event\n \t\t// Fired when the marker stops moving (because of dragging).\n \t\tdelete this._oldLatLng;\n \t\tthis._marker\n \t\t .fire('moveend')\n \t\t .fire('dragend', e);\n \t}\n });\n\n /*\r\n * @class Marker\r\n * @inherits Interactive layer\r\n * @aka L.Marker\r\n * L.Marker is used to display clickable/draggable icons on the map. Extends `Layer`.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * L.marker([50.5, 30.5]).addTo(map);\r\n * ```\r\n */\r\n\r\n var Marker = Layer.extend({\r\n\r\n \t// @section\r\n \t// @aka Marker options\r\n \toptions: {\r\n \t\t// @option icon: Icon = *\r\n \t\t// Icon instance to use for rendering the marker.\r\n \t\t// See [Icon documentation](#L.Icon) for details on how to customize the marker icon.\r\n \t\t// If not specified, a common instance of `L.Icon.Default` is used.\r\n \t\ticon: new IconDefault(),\r\n\r\n \t\t// Option inherited from \"Interactive layer\" abstract class\r\n \t\tinteractive: true,\r\n\r\n \t\t// @option keyboard: Boolean = true\r\n \t\t// Whether the marker can be tabbed to with a keyboard and clicked by pressing enter.\r\n \t\tkeyboard: true,\r\n\r\n \t\t// @option title: String = ''\r\n \t\t// Text for the browser tooltip that appear on marker hover (no tooltip by default).\r\n \t\ttitle: '',\r\n\r\n \t\t// @option alt: String = ''\r\n \t\t// Text for the `alt` attribute of the icon image (useful for accessibility).\r\n \t\talt: '',\r\n\r\n \t\t// @option zIndexOffset: Number = 0\r\n \t\t// By default, marker images zIndex is set automatically based on its latitude. Use this option if you want to put the marker on top of all others (or below), specifying a high value like `1000` (or high negative value, respectively).\r\n \t\tzIndexOffset: 0,\r\n\r\n \t\t// @option opacity: Number = 1.0\r\n \t\t// The opacity of the marker.\r\n \t\topacity: 1,\r\n\r\n \t\t// @option riseOnHover: Boolean = false\r\n \t\t// If `true`, the marker will get on top of others when you hover the mouse over it.\r\n \t\triseOnHover: false,\r\n\r\n \t\t// @option riseOffset: Number = 250\r\n \t\t// The z-index offset used for the `riseOnHover` feature.\r\n \t\triseOffset: 250,\r\n\r\n \t\t// @option pane: String = 'markerPane'\r\n \t\t// `Map pane` where the markers icon will be added.\r\n \t\tpane: 'markerPane',\r\n\r\n \t\t// @option shadowPane: String = 'shadowPane'\r\n \t\t// `Map pane` where the markers shadow will be added.\r\n \t\tshadowPane: 'shadowPane',\r\n\r\n \t\t// @option bubblingMouseEvents: Boolean = false\r\n \t\t// When `true`, a mouse event on this marker will trigger the same event on the map\r\n \t\t// (unless [`L.DomEvent.stopPropagation`](#domevent-stoppropagation) is used).\r\n \t\tbubblingMouseEvents: false,\r\n\r\n \t\t// @section Draggable marker options\r\n \t\t// @option draggable: Boolean = false\r\n \t\t// Whether the marker is draggable with mouse/touch or not.\r\n \t\tdraggable: false,\r\n\r\n \t\t// @option autoPan: Boolean = false\r\n \t\t// Whether to pan the map when dragging this marker near its edge or not.\r\n \t\tautoPan: false,\r\n\r\n \t\t// @option autoPanPadding: Point = Point(50, 50)\r\n \t\t// Distance (in pixels to the left/right and to the top/bottom) of the\r\n \t\t// map edge to start panning the map.\r\n \t\tautoPanPadding: [50, 50],\r\n\r\n \t\t// @option autoPanSpeed: Number = 10\r\n \t\t// Number of pixels the map should pan by.\r\n \t\tautoPanSpeed: 10\r\n \t},\r\n\r\n \t/* @section\r\n \t *\r\n \t * In addition to [shared layer methods](#Layer) like `addTo()` and `remove()` and [popup methods](#Popup) like bindPopup() you can also use the following methods:\r\n \t */\r\n\r\n \tinitialize: function (latlng, options) {\r\n \t\tsetOptions(this, options);\r\n \t\tthis._latlng = toLatLng(latlng);\r\n \t},\r\n\r\n \tonAdd: function (map) {\r\n \t\tthis._zoomAnimated = this._zoomAnimated && map.options.markerZoomAnimation;\r\n\r\n \t\tif (this._zoomAnimated) {\r\n \t\t\tmap.on('zoomanim', this._animateZoom, this);\r\n \t\t}\r\n\r\n \t\tthis._initIcon();\r\n \t\tthis.update();\r\n \t},\r\n\r\n \tonRemove: function (map) {\r\n \t\tif (this.dragging && this.dragging.enabled()) {\r\n \t\t\tthis.options.draggable = true;\r\n \t\t\tthis.dragging.removeHooks();\r\n \t\t}\r\n \t\tdelete this.dragging;\r\n\r\n \t\tif (this._zoomAnimated) {\r\n \t\t\tmap.off('zoomanim', this._animateZoom, this);\r\n \t\t}\r\n\r\n \t\tthis._removeIcon();\r\n \t\tthis._removeShadow();\r\n \t},\r\n\r\n \tgetEvents: function () {\r\n \t\treturn {\r\n \t\t\tzoom: this.update,\r\n \t\t\tviewreset: this.update\r\n \t\t};\r\n \t},\r\n\r\n \t// @method getLatLng: LatLng\r\n \t// Returns the current geographical position of the marker.\r\n \tgetLatLng: function () {\r\n \t\treturn this._latlng;\r\n \t},\r\n\r\n \t// @method setLatLng(latlng: LatLng): this\r\n \t// Changes the marker position to the given point.\r\n \tsetLatLng: function (latlng) {\r\n \t\tvar oldLatLng = this._latlng;\r\n \t\tthis._latlng = toLatLng(latlng);\r\n \t\tthis.update();\r\n\r\n \t\t// @event move: Event\r\n \t\t// Fired when the marker is moved via [`setLatLng`](#marker-setlatlng) or by [dragging](#marker-dragging). Old and new coordinates are included in event arguments as `oldLatLng`, `latlng`.\r\n \t\treturn this.fire('move', {oldLatLng: oldLatLng, latlng: this._latlng});\r\n \t},\r\n\r\n \t// @method setZIndexOffset(offset: Number): this\r\n \t// Changes the [zIndex offset](#marker-zindexoffset) of the marker.\r\n \tsetZIndexOffset: function (offset) {\r\n \t\tthis.options.zIndexOffset = offset;\r\n \t\treturn this.update();\r\n \t},\r\n\r\n \t// @method getIcon: Icon\r\n \t// Returns the current icon used by the marker\r\n \tgetIcon: function () {\r\n \t\treturn this.options.icon;\r\n \t},\r\n\r\n \t// @method setIcon(icon: Icon): this\r\n \t// Changes the marker icon.\r\n \tsetIcon: function (icon) {\r\n\r\n \t\tthis.options.icon = icon;\r\n\r\n \t\tif (this._map) {\r\n \t\t\tthis._initIcon();\r\n \t\t\tthis.update();\r\n \t\t}\r\n\r\n \t\tif (this._popup) {\r\n \t\t\tthis.bindPopup(this._popup, this._popup.options);\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \tgetElement: function () {\r\n \t\treturn this._icon;\r\n \t},\r\n\r\n \tupdate: function () {\r\n\r\n \t\tif (this._icon && this._map) {\r\n \t\t\tvar pos = this._map.latLngToLayerPoint(this._latlng).round();\r\n \t\t\tthis._setPos(pos);\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t_initIcon: function () {\r\n \t\tvar options = this.options,\r\n \t\t classToAdd = 'leaflet-zoom-' + (this._zoomAnimated ? 'animated' : 'hide');\r\n\r\n \t\tvar icon = options.icon.createIcon(this._icon),\r\n \t\t addIcon = false;\r\n\r\n \t\t// if we're not reusing the icon, remove the old one and init new one\r\n \t\tif (icon !== this._icon) {\r\n \t\t\tif (this._icon) {\r\n \t\t\t\tthis._removeIcon();\r\n \t\t\t}\r\n \t\t\taddIcon = true;\r\n\r\n \t\t\tif (options.title) {\r\n \t\t\t\ticon.title = options.title;\r\n \t\t\t}\r\n\r\n \t\t\tif (icon.tagName === 'IMG') {\r\n \t\t\t\ticon.alt = options.alt || '';\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\taddClass(icon, classToAdd);\r\n\r\n \t\tif (options.keyboard) {\r\n \t\t\ticon.tabIndex = '0';\r\n \t\t}\r\n\r\n \t\tthis._icon = icon;\r\n\r\n \t\tif (options.riseOnHover) {\r\n \t\t\tthis.on({\r\n \t\t\t\tmouseover: this._bringToFront,\r\n \t\t\t\tmouseout: this._resetZIndex\r\n \t\t\t});\r\n \t\t}\r\n\r\n \t\tvar newShadow = options.icon.createShadow(this._shadow),\r\n \t\t addShadow = false;\r\n\r\n \t\tif (newShadow !== this._shadow) {\r\n \t\t\tthis._removeShadow();\r\n \t\t\taddShadow = true;\r\n \t\t}\r\n\r\n \t\tif (newShadow) {\r\n \t\t\taddClass(newShadow, classToAdd);\r\n \t\t\tnewShadow.alt = '';\r\n \t\t}\r\n \t\tthis._shadow = newShadow;\r\n\r\n\r\n \t\tif (options.opacity < 1) {\r\n \t\t\tthis._updateOpacity();\r\n \t\t}\r\n\r\n\r\n \t\tif (addIcon) {\r\n \t\t\tthis.getPane().appendChild(this._icon);\r\n \t\t}\r\n \t\tthis._initInteraction();\r\n \t\tif (newShadow && addShadow) {\r\n \t\t\tthis.getPane(options.shadowPane).appendChild(this._shadow);\r\n \t\t}\r\n \t},\r\n\r\n \t_removeIcon: function () {\r\n \t\tif (this.options.riseOnHover) {\r\n \t\t\tthis.off({\r\n \t\t\t\tmouseover: this._bringToFront,\r\n \t\t\t\tmouseout: this._resetZIndex\r\n \t\t\t});\r\n \t\t}\r\n\r\n \t\tremove(this._icon);\r\n \t\tthis.removeInteractiveTarget(this._icon);\r\n\r\n \t\tthis._icon = null;\r\n \t},\r\n\r\n \t_removeShadow: function () {\r\n \t\tif (this._shadow) {\r\n \t\t\tremove(this._shadow);\r\n \t\t}\r\n \t\tthis._shadow = null;\r\n \t},\r\n\r\n \t_setPos: function (pos) {\r\n\r\n \t\tif (this._icon) {\r\n \t\t\tsetPosition(this._icon, pos);\r\n \t\t}\r\n\r\n \t\tif (this._shadow) {\r\n \t\t\tsetPosition(this._shadow, pos);\r\n \t\t}\r\n\r\n \t\tthis._zIndex = pos.y + this.options.zIndexOffset;\r\n\r\n \t\tthis._resetZIndex();\r\n \t},\r\n\r\n \t_updateZIndex: function (offset) {\r\n \t\tif (this._icon) {\r\n \t\t\tthis._icon.style.zIndex = this._zIndex + offset;\r\n \t\t}\r\n \t},\r\n\r\n \t_animateZoom: function (opt) {\r\n \t\tvar pos = this._map._latLngToNewLayerPoint(this._latlng, opt.zoom, opt.center).round();\r\n\r\n \t\tthis._setPos(pos);\r\n \t},\r\n\r\n \t_initInteraction: function () {\r\n\r\n \t\tif (!this.options.interactive) { return; }\r\n\r\n \t\taddClass(this._icon, 'leaflet-interactive');\r\n\r\n \t\tthis.addInteractiveTarget(this._icon);\r\n\r\n \t\tif (MarkerDrag) {\r\n \t\t\tvar draggable = this.options.draggable;\r\n \t\t\tif (this.dragging) {\r\n \t\t\t\tdraggable = this.dragging.enabled();\r\n \t\t\t\tthis.dragging.disable();\r\n \t\t\t}\r\n\r\n \t\t\tthis.dragging = new MarkerDrag(this);\r\n\r\n \t\t\tif (draggable) {\r\n \t\t\t\tthis.dragging.enable();\r\n \t\t\t}\r\n \t\t}\r\n \t},\r\n\r\n \t// @method setOpacity(opacity: Number): this\r\n \t// Changes the opacity of the marker.\r\n \tsetOpacity: function (opacity) {\r\n \t\tthis.options.opacity = opacity;\r\n \t\tif (this._map) {\r\n \t\t\tthis._updateOpacity();\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t_updateOpacity: function () {\r\n \t\tvar opacity = this.options.opacity;\r\n\r\n \t\tif (this._icon) {\r\n \t\t\tsetOpacity(this._icon, opacity);\r\n \t\t}\r\n\r\n \t\tif (this._shadow) {\r\n \t\t\tsetOpacity(this._shadow, opacity);\r\n \t\t}\r\n \t},\r\n\r\n \t_bringToFront: function () {\r\n \t\tthis._updateZIndex(this.options.riseOffset);\r\n \t},\r\n\r\n \t_resetZIndex: function () {\r\n \t\tthis._updateZIndex(0);\r\n \t},\r\n\r\n \t_getPopupAnchor: function () {\r\n \t\treturn this.options.icon.options.popupAnchor;\r\n \t},\r\n\r\n \t_getTooltipAnchor: function () {\r\n \t\treturn this.options.icon.options.tooltipAnchor;\r\n \t}\r\n });\r\n\r\n\r\n // factory L.marker(latlng: LatLng, options? : Marker options)\r\n\r\n // @factory L.marker(latlng: LatLng, options? : Marker options)\r\n // Instantiates a Marker object given a geographical point and optionally an options object.\r\n function marker(latlng, options) {\r\n \treturn new Marker(latlng, options);\r\n }\n\n /*\n * @class Path\n * @aka L.Path\n * @inherits Interactive layer\n *\n * An abstract class that contains options and constants shared between vector\n * overlays (Polygon, Polyline, Circle). Do not use it directly. Extends `Layer`.\n */\n\n var Path = Layer.extend({\n\n \t// @section\n \t// @aka Path options\n \toptions: {\n \t\t// @option stroke: Boolean = true\n \t\t// Whether to draw stroke along the path. Set it to `false` to disable borders on polygons or circles.\n \t\tstroke: true,\n\n \t\t// @option color: String = '#3388ff'\n \t\t// Stroke color\n \t\tcolor: '#3388ff',\n\n \t\t// @option weight: Number = 3\n \t\t// Stroke width in pixels\n \t\tweight: 3,\n\n \t\t// @option opacity: Number = 1.0\n \t\t// Stroke opacity\n \t\topacity: 1,\n\n \t\t// @option lineCap: String= 'round'\n \t\t// A string that defines [shape to be used at the end](https://developer.mozilla.org/docs/Web/SVG/Attribute/stroke-linecap) of the stroke.\n \t\tlineCap: 'round',\n\n \t\t// @option lineJoin: String = 'round'\n \t\t// A string that defines [shape to be used at the corners](https://developer.mozilla.org/docs/Web/SVG/Attribute/stroke-linejoin) of the stroke.\n \t\tlineJoin: 'round',\n\n \t\t// @option dashArray: String = null\n \t\t// A string that defines the stroke [dash pattern](https://developer.mozilla.org/docs/Web/SVG/Attribute/stroke-dasharray). Doesn't work on `Canvas`-powered layers in [some old browsers](https://developer.mozilla.org/docs/Web/API/CanvasRenderingContext2D/setLineDash#Browser_compatibility).\n \t\tdashArray: null,\n\n \t\t// @option dashOffset: String = null\n \t\t// A string that defines the [distance into the dash pattern to start the dash](https://developer.mozilla.org/docs/Web/SVG/Attribute/stroke-dashoffset). Doesn't work on `Canvas`-powered layers in [some old browsers](https://developer.mozilla.org/docs/Web/API/CanvasRenderingContext2D/setLineDash#Browser_compatibility).\n \t\tdashOffset: null,\n\n \t\t// @option fill: Boolean = depends\n \t\t// Whether to fill the path with color. Set it to `false` to disable filling on polygons or circles.\n \t\tfill: false,\n\n \t\t// @option fillColor: String = *\n \t\t// Fill color. Defaults to the value of the [`color`](#path-color) option\n \t\tfillColor: null,\n\n \t\t// @option fillOpacity: Number = 0.2\n \t\t// Fill opacity.\n \t\tfillOpacity: 0.2,\n\n \t\t// @option fillRule: String = 'evenodd'\n \t\t// A string that defines [how the inside of a shape](https://developer.mozilla.org/docs/Web/SVG/Attribute/fill-rule) is determined.\n \t\tfillRule: 'evenodd',\n\n \t\t// className: '',\n\n \t\t// Option inherited from \"Interactive layer\" abstract class\n \t\tinteractive: true,\n\n \t\t// @option bubblingMouseEvents: Boolean = true\n \t\t// When `true`, a mouse event on this path will trigger the same event on the map\n \t\t// (unless [`L.DomEvent.stopPropagation`](#domevent-stoppropagation) is used).\n \t\tbubblingMouseEvents: true\n \t},\n\n \tbeforeAdd: function (map) {\n \t\t// Renderer is set here because we need to call renderer.getEvents\n \t\t// before this.getEvents.\n \t\tthis._renderer = map.getRenderer(this);\n \t},\n\n \tonAdd: function () {\n \t\tthis._renderer._initPath(this);\n \t\tthis._reset();\n \t\tthis._renderer._addPath(this);\n \t},\n\n \tonRemove: function () {\n \t\tthis._renderer._removePath(this);\n \t},\n\n \t// @method redraw(): this\n \t// Redraws the layer. Sometimes useful after you changed the coordinates that the path uses.\n \tredraw: function () {\n \t\tif (this._map) {\n \t\t\tthis._renderer._updatePath(this);\n \t\t}\n \t\treturn this;\n \t},\n\n \t// @method setStyle(style: Path options): this\n \t// Changes the appearance of a Path based on the options in the `Path options` object.\n \tsetStyle: function (style) {\n \t\tsetOptions(this, style);\n \t\tif (this._renderer) {\n \t\t\tthis._renderer._updateStyle(this);\n \t\t\tif (this.options.stroke && style && Object.prototype.hasOwnProperty.call(style, 'weight')) {\n \t\t\t\tthis._updateBounds();\n \t\t\t}\n \t\t}\n \t\treturn this;\n \t},\n\n \t// @method bringToFront(): this\n \t// Brings the layer to the top of all path layers.\n \tbringToFront: function () {\n \t\tif (this._renderer) {\n \t\t\tthis._renderer._bringToFront(this);\n \t\t}\n \t\treturn this;\n \t},\n\n \t// @method bringToBack(): this\n \t// Brings the layer to the bottom of all path layers.\n \tbringToBack: function () {\n \t\tif (this._renderer) {\n \t\t\tthis._renderer._bringToBack(this);\n \t\t}\n \t\treturn this;\n \t},\n\n \tgetElement: function () {\n \t\treturn this._path;\n \t},\n\n \t_reset: function () {\n \t\t// defined in child classes\n \t\tthis._project();\n \t\tthis._update();\n \t},\n\n \t_clickTolerance: function () {\n \t\t// used when doing hit detection for Canvas layers\n \t\treturn (this.options.stroke ? this.options.weight / 2 : 0) + this._renderer.options.tolerance;\n \t}\n });\n\n /*\n * @class CircleMarker\n * @aka L.CircleMarker\n * @inherits Path\n *\n * A circle of a fixed size with radius specified in pixels. Extends `Path`.\n */\n\n var CircleMarker = Path.extend({\n\n \t// @section\n \t// @aka CircleMarker options\n \toptions: {\n \t\tfill: true,\n\n \t\t// @option radius: Number = 10\n \t\t// Radius of the circle marker, in pixels\n \t\tradius: 10\n \t},\n\n \tinitialize: function (latlng, options) {\n \t\tsetOptions(this, options);\n \t\tthis._latlng = toLatLng(latlng);\n \t\tthis._radius = this.options.radius;\n \t},\n\n \t// @method setLatLng(latLng: LatLng): this\n \t// Sets the position of a circle marker to a new location.\n \tsetLatLng: function (latlng) {\n \t\tvar oldLatLng = this._latlng;\n \t\tthis._latlng = toLatLng(latlng);\n \t\tthis.redraw();\n\n \t\t// @event move: Event\n \t\t// Fired when the marker is moved via [`setLatLng`](#circlemarker-setlatlng). Old and new coordinates are included in event arguments as `oldLatLng`, `latlng`.\n \t\treturn this.fire('move', {oldLatLng: oldLatLng, latlng: this._latlng});\n \t},\n\n \t// @method getLatLng(): LatLng\n \t// Returns the current geographical position of the circle marker\n \tgetLatLng: function () {\n \t\treturn this._latlng;\n \t},\n\n \t// @method setRadius(radius: Number): this\n \t// Sets the radius of a circle marker. Units are in pixels.\n \tsetRadius: function (radius) {\n \t\tthis.options.radius = this._radius = radius;\n \t\treturn this.redraw();\n \t},\n\n \t// @method getRadius(): Number\n \t// Returns the current radius of the circle\n \tgetRadius: function () {\n \t\treturn this._radius;\n \t},\n\n \tsetStyle : function (options) {\n \t\tvar radius = options && options.radius || this._radius;\n \t\tPath.prototype.setStyle.call(this, options);\n \t\tthis.setRadius(radius);\n \t\treturn this;\n \t},\n\n \t_project: function () {\n \t\tthis._point = this._map.latLngToLayerPoint(this._latlng);\n \t\tthis._updateBounds();\n \t},\n\n \t_updateBounds: function () {\n \t\tvar r = this._radius,\n \t\t r2 = this._radiusY || r,\n \t\t w = this._clickTolerance(),\n \t\t p = [r + w, r2 + w];\n \t\tthis._pxBounds = new Bounds(this._point.subtract(p), this._point.add(p));\n \t},\n\n \t_update: function () {\n \t\tif (this._map) {\n \t\t\tthis._updatePath();\n \t\t}\n \t},\n\n \t_updatePath: function () {\n \t\tthis._renderer._updateCircle(this);\n \t},\n\n \t_empty: function () {\n \t\treturn this._radius && !this._renderer._bounds.intersects(this._pxBounds);\n \t},\n\n \t// Needed by the `Canvas` renderer for interactivity\n \t_containsPoint: function (p) {\n \t\treturn p.distanceTo(this._point) <= this._radius + this._clickTolerance();\n \t}\n });\n\n\n // @factory L.circleMarker(latlng: LatLng, options?: CircleMarker options)\n // Instantiates a circle marker object given a geographical point, and an optional options object.\n function circleMarker(latlng, options) {\n \treturn new CircleMarker(latlng, options);\n }\n\n /*\n * @class Circle\n * @aka L.Circle\n * @inherits CircleMarker\n *\n * A class for drawing circle overlays on a map. Extends `CircleMarker`.\n *\n * It's an approximation and starts to diverge from a real circle closer to poles (due to projection distortion).\n *\n * @example\n *\n * ```js\n * L.circle([50.5, 30.5], {radius: 200}).addTo(map);\n * ```\n */\n\n var Circle = CircleMarker.extend({\n\n \tinitialize: function (latlng, options, legacyOptions) {\n \t\tif (typeof options === 'number') {\n \t\t\t// Backwards compatibility with 0.7.x factory (latlng, radius, options?)\n \t\t\toptions = extend({}, legacyOptions, {radius: options});\n \t\t}\n \t\tsetOptions(this, options);\n \t\tthis._latlng = toLatLng(latlng);\n\n \t\tif (isNaN(this.options.radius)) { throw new Error('Circle radius cannot be NaN'); }\n\n \t\t// @section\n \t\t// @aka Circle options\n \t\t// @option radius: Number; Radius of the circle, in meters.\n \t\tthis._mRadius = this.options.radius;\n \t},\n\n \t// @method setRadius(radius: Number): this\n \t// Sets the radius of a circle. Units are in meters.\n \tsetRadius: function (radius) {\n \t\tthis._mRadius = radius;\n \t\treturn this.redraw();\n \t},\n\n \t// @method getRadius(): Number\n \t// Returns the current radius of a circle. Units are in meters.\n \tgetRadius: function () {\n \t\treturn this._mRadius;\n \t},\n\n \t// @method getBounds(): LatLngBounds\n \t// Returns the `LatLngBounds` of the path.\n \tgetBounds: function () {\n \t\tvar half = [this._radius, this._radiusY || this._radius];\n\n \t\treturn new LatLngBounds(\n \t\t\tthis._map.layerPointToLatLng(this._point.subtract(half)),\n \t\t\tthis._map.layerPointToLatLng(this._point.add(half)));\n \t},\n\n \tsetStyle: Path.prototype.setStyle,\n\n \t_project: function () {\n\n \t\tvar lng = this._latlng.lng,\n \t\t lat = this._latlng.lat,\n \t\t map = this._map,\n \t\t crs = map.options.crs;\n\n \t\tif (crs.distance === Earth.distance) {\n \t\t\tvar d = Math.PI / 180,\n \t\t\t latR = (this._mRadius / Earth.R) / d,\n \t\t\t top = map.project([lat + latR, lng]),\n \t\t\t bottom = map.project([lat - latR, lng]),\n \t\t\t p = top.add(bottom).divideBy(2),\n \t\t\t lat2 = map.unproject(p).lat,\n \t\t\t lngR = Math.acos((Math.cos(latR * d) - Math.sin(lat * d) * Math.sin(lat2 * d)) /\n \t\t\t (Math.cos(lat * d) * Math.cos(lat2 * d))) / d;\n\n \t\t\tif (isNaN(lngR) || lngR === 0) {\n \t\t\t\tlngR = latR / Math.cos(Math.PI / 180 * lat); // Fallback for edge case, #2425\n \t\t\t}\n\n \t\t\tthis._point = p.subtract(map.getPixelOrigin());\n \t\t\tthis._radius = isNaN(lngR) ? 0 : p.x - map.project([lat2, lng - lngR]).x;\n \t\t\tthis._radiusY = p.y - top.y;\n\n \t\t} else {\n \t\t\tvar latlng2 = crs.unproject(crs.project(this._latlng).subtract([this._mRadius, 0]));\n\n \t\t\tthis._point = map.latLngToLayerPoint(this._latlng);\n \t\t\tthis._radius = this._point.x - map.latLngToLayerPoint(latlng2).x;\n \t\t}\n\n \t\tthis._updateBounds();\n \t}\n });\n\n // @factory L.circle(latlng: LatLng, options?: Circle options)\n // Instantiates a circle object given a geographical point, and an options object\n // which contains the circle radius.\n // @alternative\n // @factory L.circle(latlng: LatLng, radius: Number, options?: Circle options)\n // Obsolete way of instantiating a circle, for compatibility with 0.7.x code.\n // Do not use in new applications or plugins.\n function circle(latlng, options, legacyOptions) {\n \treturn new Circle(latlng, options, legacyOptions);\n }\n\n /*\n * @class Polyline\n * @aka L.Polyline\n * @inherits Path\n *\n * A class for drawing polyline overlays on a map. Extends `Path`.\n *\n * @example\n *\n * ```js\n * // create a red polyline from an array of LatLng points\n * var latlngs = [\n * \t[45.51, -122.68],\n * \t[37.77, -122.43],\n * \t[34.04, -118.2]\n * ];\n *\n * var polyline = L.polyline(latlngs, {color: 'red'}).addTo(map);\n *\n * // zoom the map to the polyline\n * map.fitBounds(polyline.getBounds());\n * ```\n *\n * You can also pass a multi-dimensional array to represent a `MultiPolyline` shape:\n *\n * ```js\n * // create a red polyline from an array of arrays of LatLng points\n * var latlngs = [\n * \t[[45.51, -122.68],\n * \t [37.77, -122.43],\n * \t [34.04, -118.2]],\n * \t[[40.78, -73.91],\n * \t [41.83, -87.62],\n * \t [32.76, -96.72]]\n * ];\n * ```\n */\n\n\n var Polyline = Path.extend({\n\n \t// @section\n \t// @aka Polyline options\n \toptions: {\n \t\t// @option smoothFactor: Number = 1.0\n \t\t// How much to simplify the polyline on each zoom level. More means\n \t\t// better performance and smoother look, and less means more accurate representation.\n \t\tsmoothFactor: 1.0,\n\n \t\t// @option noClip: Boolean = false\n \t\t// Disable polyline clipping.\n \t\tnoClip: false\n \t},\n\n \tinitialize: function (latlngs, options) {\n \t\tsetOptions(this, options);\n \t\tthis._setLatLngs(latlngs);\n \t},\n\n \t// @method getLatLngs(): LatLng[]\n \t// Returns an array of the points in the path, or nested arrays of points in case of multi-polyline.\n \tgetLatLngs: function () {\n \t\treturn this._latlngs;\n \t},\n\n \t// @method setLatLngs(latlngs: LatLng[]): this\n \t// Replaces all the points in the polyline with the given array of geographical points.\n \tsetLatLngs: function (latlngs) {\n \t\tthis._setLatLngs(latlngs);\n \t\treturn this.redraw();\n \t},\n\n \t// @method isEmpty(): Boolean\n \t// Returns `true` if the Polyline has no LatLngs.\n \tisEmpty: function () {\n \t\treturn !this._latlngs.length;\n \t},\n\n \t// @method closestLayerPoint(p: Point): Point\n \t// Returns the point closest to `p` on the Polyline.\n \tclosestLayerPoint: function (p) {\n \t\tvar minDistance = Infinity,\n \t\t minPoint = null,\n \t\t closest = _sqClosestPointOnSegment,\n \t\t p1, p2;\n\n \t\tfor (var j = 0, jLen = this._parts.length; j < jLen; j++) {\n \t\t\tvar points = this._parts[j];\n\n \t\t\tfor (var i = 1, len = points.length; i < len; i++) {\n \t\t\t\tp1 = points[i - 1];\n \t\t\t\tp2 = points[i];\n\n \t\t\t\tvar sqDist = closest(p, p1, p2, true);\n\n \t\t\t\tif (sqDist < minDistance) {\n \t\t\t\t\tminDistance = sqDist;\n \t\t\t\t\tminPoint = closest(p, p1, p2);\n \t\t\t\t}\n \t\t\t}\n \t\t}\n \t\tif (minPoint) {\n \t\t\tminPoint.distance = Math.sqrt(minDistance);\n \t\t}\n \t\treturn minPoint;\n \t},\n\n \t// @method getCenter(): LatLng\n \t// Returns the center ([centroid](http://en.wikipedia.org/wiki/Centroid)) of the polyline.\n \tgetCenter: function () {\n \t\t// throws error when not yet added to map as this center calculation requires projected coordinates\n \t\tif (!this._map) {\n \t\t\tthrow new Error('Must add layer to map before using getCenter()');\n \t\t}\n\n \t\tvar i, halfDist, segDist, dist, p1, p2, ratio,\n \t\t points = this._rings[0],\n \t\t len = points.length;\n\n \t\tif (!len) { return null; }\n\n \t\t// polyline centroid algorithm; only uses the first ring if there are multiple\n\n \t\tfor (i = 0, halfDist = 0; i < len - 1; i++) {\n \t\t\thalfDist += points[i].distanceTo(points[i + 1]) / 2;\n \t\t}\n\n \t\t// The line is so small in the current view that all points are on the same pixel.\n \t\tif (halfDist === 0) {\n \t\t\treturn this._map.layerPointToLatLng(points[0]);\n \t\t}\n\n \t\tfor (i = 0, dist = 0; i < len - 1; i++) {\n \t\t\tp1 = points[i];\n \t\t\tp2 = points[i + 1];\n \t\t\tsegDist = p1.distanceTo(p2);\n \t\t\tdist += segDist;\n\n \t\t\tif (dist > halfDist) {\n \t\t\t\tratio = (dist - halfDist) / segDist;\n \t\t\t\treturn this._map.layerPointToLatLng([\n \t\t\t\t\tp2.x - ratio * (p2.x - p1.x),\n \t\t\t\t\tp2.y - ratio * (p2.y - p1.y)\n \t\t\t\t]);\n \t\t\t}\n \t\t}\n \t},\n\n \t// @method getBounds(): LatLngBounds\n \t// Returns the `LatLngBounds` of the path.\n \tgetBounds: function () {\n \t\treturn this._bounds;\n \t},\n\n \t// @method addLatLng(latlng: LatLng, latlngs?: LatLng[]): this\n \t// Adds a given point to the polyline. By default, adds to the first ring of\n \t// the polyline in case of a multi-polyline, but can be overridden by passing\n \t// a specific ring as a LatLng array (that you can earlier access with [`getLatLngs`](#polyline-getlatlngs)).\n \taddLatLng: function (latlng, latlngs) {\n \t\tlatlngs = latlngs || this._defaultShape();\n \t\tlatlng = toLatLng(latlng);\n \t\tlatlngs.push(latlng);\n \t\tthis._bounds.extend(latlng);\n \t\treturn this.redraw();\n \t},\n\n \t_setLatLngs: function (latlngs) {\n \t\tthis._bounds = new LatLngBounds();\n \t\tthis._latlngs = this._convertLatLngs(latlngs);\n \t},\n\n \t_defaultShape: function () {\n \t\treturn isFlat(this._latlngs) ? this._latlngs : this._latlngs[0];\n \t},\n\n \t// recursively convert latlngs input into actual LatLng instances; calculate bounds along the way\n \t_convertLatLngs: function (latlngs) {\n \t\tvar result = [],\n \t\t flat = isFlat(latlngs);\n\n \t\tfor (var i = 0, len = latlngs.length; i < len; i++) {\n \t\t\tif (flat) {\n \t\t\t\tresult[i] = toLatLng(latlngs[i]);\n \t\t\t\tthis._bounds.extend(result[i]);\n \t\t\t} else {\n \t\t\t\tresult[i] = this._convertLatLngs(latlngs[i]);\n \t\t\t}\n \t\t}\n\n \t\treturn result;\n \t},\n\n \t_project: function () {\n \t\tvar pxBounds = new Bounds();\n \t\tthis._rings = [];\n \t\tthis._projectLatlngs(this._latlngs, this._rings, pxBounds);\n\n \t\tif (this._bounds.isValid() && pxBounds.isValid()) {\n \t\t\tthis._rawPxBounds = pxBounds;\n \t\t\tthis._updateBounds();\n \t\t}\n \t},\n\n \t_updateBounds: function () {\n \t\tvar w = this._clickTolerance(),\n \t\t p = new Point(w, w);\n \t\tthis._pxBounds = new Bounds([\n \t\t\tthis._rawPxBounds.min.subtract(p),\n \t\t\tthis._rawPxBounds.max.add(p)\n \t\t]);\n \t},\n\n \t// recursively turns latlngs into a set of rings with projected coordinates\n \t_projectLatlngs: function (latlngs, result, projectedBounds) {\n \t\tvar flat = latlngs[0] instanceof LatLng,\n \t\t len = latlngs.length,\n \t\t i, ring;\n\n \t\tif (flat) {\n \t\t\tring = [];\n \t\t\tfor (i = 0; i < len; i++) {\n \t\t\t\tring[i] = this._map.latLngToLayerPoint(latlngs[i]);\n \t\t\t\tprojectedBounds.extend(ring[i]);\n \t\t\t}\n \t\t\tresult.push(ring);\n \t\t} else {\n \t\t\tfor (i = 0; i < len; i++) {\n \t\t\t\tthis._projectLatlngs(latlngs[i], result, projectedBounds);\n \t\t\t}\n \t\t}\n \t},\n\n \t// clip polyline by renderer bounds so that we have less to render for performance\n \t_clipPoints: function () {\n \t\tvar bounds = this._renderer._bounds;\n\n \t\tthis._parts = [];\n \t\tif (!this._pxBounds || !this._pxBounds.intersects(bounds)) {\n \t\t\treturn;\n \t\t}\n\n \t\tif (this.options.noClip) {\n \t\t\tthis._parts = this._rings;\n \t\t\treturn;\n \t\t}\n\n \t\tvar parts = this._parts,\n \t\t i, j, k, len, len2, segment, points;\n\n \t\tfor (i = 0, k = 0, len = this._rings.length; i < len; i++) {\n \t\t\tpoints = this._rings[i];\n\n \t\t\tfor (j = 0, len2 = points.length; j < len2 - 1; j++) {\n \t\t\t\tsegment = clipSegment(points[j], points[j + 1], bounds, j, true);\n\n \t\t\t\tif (!segment) { continue; }\n\n \t\t\t\tparts[k] = parts[k] || [];\n \t\t\t\tparts[k].push(segment[0]);\n\n \t\t\t\t// if segment goes out of screen, or it's the last one, it's the end of the line part\n \t\t\t\tif ((segment[1] !== points[j + 1]) || (j === len2 - 2)) {\n \t\t\t\t\tparts[k].push(segment[1]);\n \t\t\t\t\tk++;\n \t\t\t\t}\n \t\t\t}\n \t\t}\n \t},\n\n \t// simplify each clipped part of the polyline for performance\n \t_simplifyPoints: function () {\n \t\tvar parts = this._parts,\n \t\t tolerance = this.options.smoothFactor;\n\n \t\tfor (var i = 0, len = parts.length; i < len; i++) {\n \t\t\tparts[i] = simplify(parts[i], tolerance);\n \t\t}\n \t},\n\n \t_update: function () {\n \t\tif (!this._map) { return; }\n\n \t\tthis._clipPoints();\n \t\tthis._simplifyPoints();\n \t\tthis._updatePath();\n \t},\n\n \t_updatePath: function () {\n \t\tthis._renderer._updatePoly(this);\n \t},\n\n \t// Needed by the `Canvas` renderer for interactivity\n \t_containsPoint: function (p, closed) {\n \t\tvar i, j, k, len, len2, part,\n \t\t w = this._clickTolerance();\n\n \t\tif (!this._pxBounds || !this._pxBounds.contains(p)) { return false; }\n\n \t\t// hit detection for polylines\n \t\tfor (i = 0, len = this._parts.length; i < len; i++) {\n \t\t\tpart = this._parts[i];\n\n \t\t\tfor (j = 0, len2 = part.length, k = len2 - 1; j < len2; k = j++) {\n \t\t\t\tif (!closed && (j === 0)) { continue; }\n\n \t\t\t\tif (pointToSegmentDistance(p, part[k], part[j]) <= w) {\n \t\t\t\t\treturn true;\n \t\t\t\t}\n \t\t\t}\n \t\t}\n \t\treturn false;\n \t}\n });\n\n // @factory L.polyline(latlngs: LatLng[], options?: Polyline options)\n // Instantiates a polyline object given an array of geographical points and\n // optionally an options object. You can create a `Polyline` object with\n // multiple separate lines (`MultiPolyline`) by passing an array of arrays\n // of geographic points.\n function polyline(latlngs, options) {\n \treturn new Polyline(latlngs, options);\n }\n\n // Retrocompat. Allow plugins to support Leaflet versions before and after 1.1.\n Polyline._flat = _flat;\n\n /*\n * @class Polygon\n * @aka L.Polygon\n * @inherits Polyline\n *\n * A class for drawing polygon overlays on a map. Extends `Polyline`.\n *\n * Note that points you pass when creating a polygon shouldn't have an additional last point equal to the first one — it's better to filter out such points.\n *\n *\n * @example\n *\n * ```js\n * // create a red polygon from an array of LatLng points\n * var latlngs = [[37, -109.05],[41, -109.03],[41, -102.05],[37, -102.04]];\n *\n * var polygon = L.polygon(latlngs, {color: 'red'}).addTo(map);\n *\n * // zoom the map to the polygon\n * map.fitBounds(polygon.getBounds());\n * ```\n *\n * You can also pass an array of arrays of latlngs, with the first array representing the outer shape and the other arrays representing holes in the outer shape:\n *\n * ```js\n * var latlngs = [\n * [[37, -109.05],[41, -109.03],[41, -102.05],[37, -102.04]], // outer ring\n * [[37.29, -108.58],[40.71, -108.58],[40.71, -102.50],[37.29, -102.50]] // hole\n * ];\n * ```\n *\n * Additionally, you can pass a multi-dimensional array to represent a MultiPolygon shape.\n *\n * ```js\n * var latlngs = [\n * [ // first polygon\n * [[37, -109.05],[41, -109.03],[41, -102.05],[37, -102.04]], // outer ring\n * [[37.29, -108.58],[40.71, -108.58],[40.71, -102.50],[37.29, -102.50]] // hole\n * ],\n * [ // second polygon\n * [[41, -111.03],[45, -111.04],[45, -104.05],[41, -104.05]]\n * ]\n * ];\n * ```\n */\n\n var Polygon = Polyline.extend({\n\n \toptions: {\n \t\tfill: true\n \t},\n\n \tisEmpty: function () {\n \t\treturn !this._latlngs.length || !this._latlngs[0].length;\n \t},\n\n \tgetCenter: function () {\n \t\t// throws error when not yet added to map as this center calculation requires projected coordinates\n \t\tif (!this._map) {\n \t\t\tthrow new Error('Must add layer to map before using getCenter()');\n \t\t}\n\n \t\tvar i, j, p1, p2, f, area, x, y, center,\n \t\t points = this._rings[0],\n \t\t len = points.length;\n\n \t\tif (!len) { return null; }\n\n \t\t// polygon centroid algorithm; only uses the first ring if there are multiple\n\n \t\tarea = x = y = 0;\n\n \t\tfor (i = 0, j = len - 1; i < len; j = i++) {\n \t\t\tp1 = points[i];\n \t\t\tp2 = points[j];\n\n \t\t\tf = p1.y * p2.x - p2.y * p1.x;\n \t\t\tx += (p1.x + p2.x) * f;\n \t\t\ty += (p1.y + p2.y) * f;\n \t\t\tarea += f * 3;\n \t\t}\n\n \t\tif (area === 0) {\n \t\t\t// Polygon is so small that all points are on same pixel.\n \t\t\tcenter = points[0];\n \t\t} else {\n \t\t\tcenter = [x / area, y / area];\n \t\t}\n \t\treturn this._map.layerPointToLatLng(center);\n \t},\n\n \t_convertLatLngs: function (latlngs) {\n \t\tvar result = Polyline.prototype._convertLatLngs.call(this, latlngs),\n \t\t len = result.length;\n\n \t\t// remove last point if it equals first one\n \t\tif (len >= 2 && result[0] instanceof LatLng && result[0].equals(result[len - 1])) {\n \t\t\tresult.pop();\n \t\t}\n \t\treturn result;\n \t},\n\n \t_setLatLngs: function (latlngs) {\n \t\tPolyline.prototype._setLatLngs.call(this, latlngs);\n \t\tif (isFlat(this._latlngs)) {\n \t\t\tthis._latlngs = [this._latlngs];\n \t\t}\n \t},\n\n \t_defaultShape: function () {\n \t\treturn isFlat(this._latlngs[0]) ? this._latlngs[0] : this._latlngs[0][0];\n \t},\n\n \t_clipPoints: function () {\n \t\t// polygons need a different clipping algorithm so we redefine that\n\n \t\tvar bounds = this._renderer._bounds,\n \t\t w = this.options.weight,\n \t\t p = new Point(w, w);\n\n \t\t// increase clip padding by stroke width to avoid stroke on clip edges\n \t\tbounds = new Bounds(bounds.min.subtract(p), bounds.max.add(p));\n\n \t\tthis._parts = [];\n \t\tif (!this._pxBounds || !this._pxBounds.intersects(bounds)) {\n \t\t\treturn;\n \t\t}\n\n \t\tif (this.options.noClip) {\n \t\t\tthis._parts = this._rings;\n \t\t\treturn;\n \t\t}\n\n \t\tfor (var i = 0, len = this._rings.length, clipped; i < len; i++) {\n \t\t\tclipped = clipPolygon(this._rings[i], bounds, true);\n \t\t\tif (clipped.length) {\n \t\t\t\tthis._parts.push(clipped);\n \t\t\t}\n \t\t}\n \t},\n\n \t_updatePath: function () {\n \t\tthis._renderer._updatePoly(this, true);\n \t},\n\n \t// Needed by the `Canvas` renderer for interactivity\n \t_containsPoint: function (p) {\n \t\tvar inside = false,\n \t\t part, p1, p2, i, j, k, len, len2;\n\n \t\tif (!this._pxBounds || !this._pxBounds.contains(p)) { return false; }\n\n \t\t// ray casting algorithm for detecting if point is in polygon\n \t\tfor (i = 0, len = this._parts.length; i < len; i++) {\n \t\t\tpart = this._parts[i];\n\n \t\t\tfor (j = 0, len2 = part.length, k = len2 - 1; j < len2; k = j++) {\n \t\t\t\tp1 = part[j];\n \t\t\t\tp2 = part[k];\n\n \t\t\t\tif (((p1.y > p.y) !== (p2.y > p.y)) && (p.x < (p2.x - p1.x) * (p.y - p1.y) / (p2.y - p1.y) + p1.x)) {\n \t\t\t\t\tinside = !inside;\n \t\t\t\t}\n \t\t\t}\n \t\t}\n\n \t\t// also check if it's on polygon stroke\n \t\treturn inside || Polyline.prototype._containsPoint.call(this, p, true);\n \t}\n\n });\n\n\n // @factory L.polygon(latlngs: LatLng[], options?: Polyline options)\n function polygon(latlngs, options) {\n \treturn new Polygon(latlngs, options);\n }\n\n /*\r\n * @class GeoJSON\r\n * @aka L.GeoJSON\r\n * @inherits FeatureGroup\r\n *\r\n * Represents a GeoJSON object or an array of GeoJSON objects. Allows you to parse\r\n * GeoJSON data and display it on the map. Extends `FeatureGroup`.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * L.geoJSON(data, {\r\n * \tstyle: function (feature) {\r\n * \t\treturn {color: feature.properties.color};\r\n * \t}\r\n * }).bindPopup(function (layer) {\r\n * \treturn layer.feature.properties.description;\r\n * }).addTo(map);\r\n * ```\r\n */\r\n\r\n var GeoJSON = FeatureGroup.extend({\r\n\r\n \t/* @section\r\n \t * @aka GeoJSON options\r\n \t *\r\n \t * @option pointToLayer: Function = *\r\n \t * A `Function` defining how GeoJSON points spawn Leaflet layers. It is internally\r\n \t * called when data is added, passing the GeoJSON point feature and its `LatLng`.\r\n \t * The default is to spawn a default `Marker`:\r\n \t * ```js\r\n \t * function(geoJsonPoint, latlng) {\r\n \t * \treturn L.marker(latlng);\r\n \t * }\r\n \t * ```\r\n \t *\r\n \t * @option style: Function = *\r\n \t * A `Function` defining the `Path options` for styling GeoJSON lines and polygons,\r\n \t * called internally when data is added.\r\n \t * The default value is to not override any defaults:\r\n \t * ```js\r\n \t * function (geoJsonFeature) {\r\n \t * \treturn {}\r\n \t * }\r\n \t * ```\r\n \t *\r\n \t * @option onEachFeature: Function = *\r\n \t * A `Function` that will be called once for each created `Feature`, after it has\r\n \t * been created and styled. Useful for attaching events and popups to features.\r\n \t * The default is to do nothing with the newly created layers:\r\n \t * ```js\r\n \t * function (feature, layer) {}\r\n \t * ```\r\n \t *\r\n \t * @option filter: Function = *\r\n \t * A `Function` that will be used to decide whether to include a feature or not.\r\n \t * The default is to include all features:\r\n \t * ```js\r\n \t * function (geoJsonFeature) {\r\n \t * \treturn true;\r\n \t * }\r\n \t * ```\r\n \t * Note: dynamically changing the `filter` option will have effect only on newly\r\n \t * added data. It will _not_ re-evaluate already included features.\r\n \t *\r\n \t * @option coordsToLatLng: Function = *\r\n \t * A `Function` that will be used for converting GeoJSON coordinates to `LatLng`s.\r\n \t * The default is the `coordsToLatLng` static method.\r\n \t *\r\n \t * @option markersInheritOptions: Boolean = false\r\n \t * Whether default Markers for \"Point\" type Features inherit from group options.\r\n \t */\r\n\r\n \tinitialize: function (geojson, options) {\r\n \t\tsetOptions(this, options);\r\n\r\n \t\tthis._layers = {};\r\n\r\n \t\tif (geojson) {\r\n \t\t\tthis.addData(geojson);\r\n \t\t}\r\n \t},\r\n\r\n \t// @method addData( data ): this\r\n \t// Adds a GeoJSON object to the layer.\r\n \taddData: function (geojson) {\r\n \t\tvar features = isArray(geojson) ? geojson : geojson.features,\r\n \t\t i, len, feature;\r\n\r\n \t\tif (features) {\r\n \t\t\tfor (i = 0, len = features.length; i < len; i++) {\r\n \t\t\t\t// only add this if geometry or geometries are set and not null\r\n \t\t\t\tfeature = features[i];\r\n \t\t\t\tif (feature.geometries || feature.geometry || feature.features || feature.coordinates) {\r\n \t\t\t\t\tthis.addData(feature);\r\n \t\t\t\t}\r\n \t\t\t}\r\n \t\t\treturn this;\r\n \t\t}\r\n\r\n \t\tvar options = this.options;\r\n\r\n \t\tif (options.filter && !options.filter(geojson)) { return this; }\r\n\r\n \t\tvar layer = geometryToLayer(geojson, options);\r\n \t\tif (!layer) {\r\n \t\t\treturn this;\r\n \t\t}\r\n \t\tlayer.feature = asFeature(geojson);\r\n\r\n \t\tlayer.defaultOptions = layer.options;\r\n \t\tthis.resetStyle(layer);\r\n\r\n \t\tif (options.onEachFeature) {\r\n \t\t\toptions.onEachFeature(geojson, layer);\r\n \t\t}\r\n\r\n \t\treturn this.addLayer(layer);\r\n \t},\r\n\r\n \t// @method resetStyle( layer? ): this\r\n \t// Resets the given vector layer's style to the original GeoJSON style, useful for resetting style after hover events.\r\n \t// If `layer` is omitted, the style of all features in the current layer is reset.\r\n \tresetStyle: function (layer) {\r\n \t\tif (layer === undefined) {\r\n \t\t\treturn this.eachLayer(this.resetStyle, this);\r\n \t\t}\r\n \t\t// reset any custom styles\r\n \t\tlayer.options = extend({}, layer.defaultOptions);\r\n \t\tthis._setLayerStyle(layer, this.options.style);\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method setStyle( style ): this\r\n \t// Changes styles of GeoJSON vector layers with the given style function.\r\n \tsetStyle: function (style) {\r\n \t\treturn this.eachLayer(function (layer) {\r\n \t\t\tthis._setLayerStyle(layer, style);\r\n \t\t}, this);\r\n \t},\r\n\r\n \t_setLayerStyle: function (layer, style) {\r\n \t\tif (layer.setStyle) {\r\n \t\t\tif (typeof style === 'function') {\r\n \t\t\t\tstyle = style(layer.feature);\r\n \t\t\t}\r\n \t\t\tlayer.setStyle(style);\r\n \t\t}\r\n \t}\r\n });\r\n\r\n // @section\r\n // There are several static functions which can be called without instantiating L.GeoJSON:\r\n\r\n // @function geometryToLayer(featureData: Object, options?: GeoJSON options): Layer\r\n // Creates a `Layer` from a given GeoJSON feature. Can use a custom\r\n // [`pointToLayer`](#geojson-pointtolayer) and/or [`coordsToLatLng`](#geojson-coordstolatlng)\r\n // functions if provided as options.\r\n function geometryToLayer(geojson, options) {\r\n\r\n \tvar geometry = geojson.type === 'Feature' ? geojson.geometry : geojson,\r\n \t coords = geometry ? geometry.coordinates : null,\r\n \t layers = [],\r\n \t pointToLayer = options && options.pointToLayer,\r\n \t _coordsToLatLng = options && options.coordsToLatLng || coordsToLatLng,\r\n \t latlng, latlngs, i, len;\r\n\r\n \tif (!coords && !geometry) {\r\n \t\treturn null;\r\n \t}\r\n\r\n \tswitch (geometry.type) {\r\n \tcase 'Point':\r\n \t\tlatlng = _coordsToLatLng(coords);\r\n \t\treturn _pointToLayer(pointToLayer, geojson, latlng, options);\r\n\r\n \tcase 'MultiPoint':\r\n \t\tfor (i = 0, len = coords.length; i < len; i++) {\r\n \t\t\tlatlng = _coordsToLatLng(coords[i]);\r\n \t\t\tlayers.push(_pointToLayer(pointToLayer, geojson, latlng, options));\r\n \t\t}\r\n \t\treturn new FeatureGroup(layers);\r\n\r\n \tcase 'LineString':\r\n \tcase 'MultiLineString':\r\n \t\tlatlngs = coordsToLatLngs(coords, geometry.type === 'LineString' ? 0 : 1, _coordsToLatLng);\r\n \t\treturn new Polyline(latlngs, options);\r\n\r\n \tcase 'Polygon':\r\n \tcase 'MultiPolygon':\r\n \t\tlatlngs = coordsToLatLngs(coords, geometry.type === 'Polygon' ? 1 : 2, _coordsToLatLng);\r\n \t\treturn new Polygon(latlngs, options);\r\n\r\n \tcase 'GeometryCollection':\r\n \t\tfor (i = 0, len = geometry.geometries.length; i < len; i++) {\r\n \t\t\tvar layer = geometryToLayer({\r\n \t\t\t\tgeometry: geometry.geometries[i],\r\n \t\t\t\ttype: 'Feature',\r\n \t\t\t\tproperties: geojson.properties\r\n \t\t\t}, options);\r\n\r\n \t\t\tif (layer) {\r\n \t\t\t\tlayers.push(layer);\r\n \t\t\t}\r\n \t\t}\r\n \t\treturn new FeatureGroup(layers);\r\n\r\n \tdefault:\r\n \t\tthrow new Error('Invalid GeoJSON object.');\r\n \t}\r\n }\r\n\r\n function _pointToLayer(pointToLayerFn, geojson, latlng, options) {\r\n \treturn pointToLayerFn ?\r\n \t\tpointToLayerFn(geojson, latlng) :\r\n \t\tnew Marker(latlng, options && options.markersInheritOptions && options);\r\n }\r\n\r\n // @function coordsToLatLng(coords: Array): LatLng\r\n // Creates a `LatLng` object from an array of 2 numbers (longitude, latitude)\r\n // or 3 numbers (longitude, latitude, altitude) used in GeoJSON for points.\r\n function coordsToLatLng(coords) {\r\n \treturn new LatLng(coords[1], coords[0], coords[2]);\r\n }\r\n\r\n // @function coordsToLatLngs(coords: Array, levelsDeep?: Number, coordsToLatLng?: Function): Array\r\n // Creates a multidimensional array of `LatLng`s from a GeoJSON coordinates array.\r\n // `levelsDeep` specifies the nesting level (0 is for an array of points, 1 for an array of arrays of points, etc., 0 by default).\r\n // Can use a custom [`coordsToLatLng`](#geojson-coordstolatlng) function.\r\n function coordsToLatLngs(coords, levelsDeep, _coordsToLatLng) {\r\n \tvar latlngs = [];\r\n\r\n \tfor (var i = 0, len = coords.length, latlng; i < len; i++) {\r\n \t\tlatlng = levelsDeep ?\r\n \t\t\tcoordsToLatLngs(coords[i], levelsDeep - 1, _coordsToLatLng) :\r\n \t\t\t(_coordsToLatLng || coordsToLatLng)(coords[i]);\r\n\r\n \t\tlatlngs.push(latlng);\r\n \t}\r\n\r\n \treturn latlngs;\r\n }\r\n\r\n // @function latLngToCoords(latlng: LatLng, precision?: Number): Array\r\n // Reverse of [`coordsToLatLng`](#geojson-coordstolatlng)\r\n function latLngToCoords(latlng, precision) {\r\n \tprecision = typeof precision === 'number' ? precision : 6;\r\n \treturn latlng.alt !== undefined ?\r\n \t\t[formatNum(latlng.lng, precision), formatNum(latlng.lat, precision), formatNum(latlng.alt, precision)] :\r\n \t\t[formatNum(latlng.lng, precision), formatNum(latlng.lat, precision)];\r\n }\r\n\r\n // @function latLngsToCoords(latlngs: Array, levelsDeep?: Number, closed?: Boolean): Array\r\n // Reverse of [`coordsToLatLngs`](#geojson-coordstolatlngs)\r\n // `closed` determines whether the first point should be appended to the end of the array to close the feature, only used when `levelsDeep` is 0. False by default.\r\n function latLngsToCoords(latlngs, levelsDeep, closed, precision) {\r\n \tvar coords = [];\r\n\r\n \tfor (var i = 0, len = latlngs.length; i < len; i++) {\r\n \t\tcoords.push(levelsDeep ?\r\n \t\t\tlatLngsToCoords(latlngs[i], levelsDeep - 1, closed, precision) :\r\n \t\t\tlatLngToCoords(latlngs[i], precision));\r\n \t}\r\n\r\n \tif (!levelsDeep && closed) {\r\n \t\tcoords.push(coords[0]);\r\n \t}\r\n\r\n \treturn coords;\r\n }\r\n\r\n function getFeature(layer, newGeometry) {\r\n \treturn layer.feature ?\r\n \t\textend({}, layer.feature, {geometry: newGeometry}) :\r\n \t\tasFeature(newGeometry);\r\n }\r\n\r\n // @function asFeature(geojson: Object): Object\r\n // Normalize GeoJSON geometries/features into GeoJSON features.\r\n function asFeature(geojson) {\r\n \tif (geojson.type === 'Feature' || geojson.type === 'FeatureCollection') {\r\n \t\treturn geojson;\r\n \t}\r\n\r\n \treturn {\r\n \t\ttype: 'Feature',\r\n \t\tproperties: {},\r\n \t\tgeometry: geojson\r\n \t};\r\n }\r\n\r\n var PointToGeoJSON = {\r\n \ttoGeoJSON: function (precision) {\r\n \t\treturn getFeature(this, {\r\n \t\t\ttype: 'Point',\r\n \t\t\tcoordinates: latLngToCoords(this.getLatLng(), precision)\r\n \t\t});\r\n \t}\r\n };\r\n\r\n // @namespace Marker\r\n // @section Other methods\r\n // @method toGeoJSON(precision?: Number): Object\r\n // `precision` is the number of decimal places for coordinates.\r\n // The default value is 6 places.\r\n // Returns a [`GeoJSON`](http://en.wikipedia.org/wiki/GeoJSON) representation of the marker (as a GeoJSON `Point` Feature).\r\n Marker.include(PointToGeoJSON);\r\n\r\n // @namespace CircleMarker\r\n // @method toGeoJSON(precision?: Number): Object\r\n // `precision` is the number of decimal places for coordinates.\r\n // The default value is 6 places.\r\n // Returns a [`GeoJSON`](http://en.wikipedia.org/wiki/GeoJSON) representation of the circle marker (as a GeoJSON `Point` Feature).\r\n Circle.include(PointToGeoJSON);\r\n CircleMarker.include(PointToGeoJSON);\r\n\r\n\r\n // @namespace Polyline\r\n // @method toGeoJSON(precision?: Number): Object\r\n // `precision` is the number of decimal places for coordinates.\r\n // The default value is 6 places.\r\n // Returns a [`GeoJSON`](http://en.wikipedia.org/wiki/GeoJSON) representation of the polyline (as a GeoJSON `LineString` or `MultiLineString` Feature).\r\n Polyline.include({\r\n \ttoGeoJSON: function (precision) {\r\n \t\tvar multi = !isFlat(this._latlngs);\r\n\r\n \t\tvar coords = latLngsToCoords(this._latlngs, multi ? 1 : 0, false, precision);\r\n\r\n \t\treturn getFeature(this, {\r\n \t\t\ttype: (multi ? 'Multi' : '') + 'LineString',\r\n \t\t\tcoordinates: coords\r\n \t\t});\r\n \t}\r\n });\r\n\r\n // @namespace Polygon\r\n // @method toGeoJSON(precision?: Number): Object\r\n // `precision` is the number of decimal places for coordinates.\r\n // The default value is 6 places.\r\n // Returns a [`GeoJSON`](http://en.wikipedia.org/wiki/GeoJSON) representation of the polygon (as a GeoJSON `Polygon` or `MultiPolygon` Feature).\r\n Polygon.include({\r\n \ttoGeoJSON: function (precision) {\r\n \t\tvar holes = !isFlat(this._latlngs),\r\n \t\t multi = holes && !isFlat(this._latlngs[0]);\r\n\r\n \t\tvar coords = latLngsToCoords(this._latlngs, multi ? 2 : holes ? 1 : 0, true, precision);\r\n\r\n \t\tif (!holes) {\r\n \t\t\tcoords = [coords];\r\n \t\t}\r\n\r\n \t\treturn getFeature(this, {\r\n \t\t\ttype: (multi ? 'Multi' : '') + 'Polygon',\r\n \t\t\tcoordinates: coords\r\n \t\t});\r\n \t}\r\n });\r\n\r\n\r\n // @namespace LayerGroup\r\n LayerGroup.include({\r\n \ttoMultiPoint: function (precision) {\r\n \t\tvar coords = [];\r\n\r\n \t\tthis.eachLayer(function (layer) {\r\n \t\t\tcoords.push(layer.toGeoJSON(precision).geometry.coordinates);\r\n \t\t});\r\n\r\n \t\treturn getFeature(this, {\r\n \t\t\ttype: 'MultiPoint',\r\n \t\t\tcoordinates: coords\r\n \t\t});\r\n \t},\r\n\r\n \t// @method toGeoJSON(precision?: Number): Object\r\n \t// `precision` is the number of decimal places for coordinates.\r\n \t// The default value is 6 places.\r\n \t// Returns a [`GeoJSON`](http://en.wikipedia.org/wiki/GeoJSON) representation of the layer group (as a GeoJSON `FeatureCollection`, `GeometryCollection`, or `MultiPoint`).\r\n \ttoGeoJSON: function (precision) {\r\n\r\n \t\tvar type = this.feature && this.feature.geometry && this.feature.geometry.type;\r\n\r\n \t\tif (type === 'MultiPoint') {\r\n \t\t\treturn this.toMultiPoint(precision);\r\n \t\t}\r\n\r\n \t\tvar isGeometryCollection = type === 'GeometryCollection',\r\n \t\t jsons = [];\r\n\r\n \t\tthis.eachLayer(function (layer) {\r\n \t\t\tif (layer.toGeoJSON) {\r\n \t\t\t\tvar json = layer.toGeoJSON(precision);\r\n \t\t\t\tif (isGeometryCollection) {\r\n \t\t\t\t\tjsons.push(json.geometry);\r\n \t\t\t\t} else {\r\n \t\t\t\t\tvar feature = asFeature(json);\r\n \t\t\t\t\t// Squash nested feature collections\r\n \t\t\t\t\tif (feature.type === 'FeatureCollection') {\r\n \t\t\t\t\t\tjsons.push.apply(jsons, feature.features);\r\n \t\t\t\t\t} else {\r\n \t\t\t\t\t\tjsons.push(feature);\r\n \t\t\t\t\t}\r\n \t\t\t\t}\r\n \t\t\t}\r\n \t\t});\r\n\r\n \t\tif (isGeometryCollection) {\r\n \t\t\treturn getFeature(this, {\r\n \t\t\t\tgeometries: jsons,\r\n \t\t\t\ttype: 'GeometryCollection'\r\n \t\t\t});\r\n \t\t}\r\n\r\n \t\treturn {\r\n \t\t\ttype: 'FeatureCollection',\r\n \t\t\tfeatures: jsons\r\n \t\t};\r\n \t}\r\n });\r\n\r\n // @namespace GeoJSON\r\n // @factory L.geoJSON(geojson?: Object, options?: GeoJSON options)\r\n // Creates a GeoJSON layer. Optionally accepts an object in\r\n // [GeoJSON format](https://tools.ietf.org/html/rfc7946) to display on the map\r\n // (you can alternatively add it later with `addData` method) and an `options` object.\r\n function geoJSON(geojson, options) {\r\n \treturn new GeoJSON(geojson, options);\r\n }\r\n\r\n // Backward compatibility.\r\n var geoJson = geoJSON;\n\n /*\r\n * @class ImageOverlay\r\n * @aka L.ImageOverlay\r\n * @inherits Interactive layer\r\n *\r\n * Used to load and display a single image over specific bounds of the map. Extends `Layer`.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * var imageUrl = 'http://www.lib.utexas.edu/maps/historical/newark_nj_1922.jpg',\r\n * \timageBounds = [[40.712216, -74.22655], [40.773941, -74.12544]];\r\n * L.imageOverlay(imageUrl, imageBounds).addTo(map);\r\n * ```\r\n */\r\n\r\n var ImageOverlay = Layer.extend({\r\n\r\n \t// @section\r\n \t// @aka ImageOverlay options\r\n \toptions: {\r\n \t\t// @option opacity: Number = 1.0\r\n \t\t// The opacity of the image overlay.\r\n \t\topacity: 1,\r\n\r\n \t\t// @option alt: String = ''\r\n \t\t// Text for the `alt` attribute of the image (useful for accessibility).\r\n \t\talt: '',\r\n\r\n \t\t// @option interactive: Boolean = false\r\n \t\t// If `true`, the image overlay will emit [mouse events](#interactive-layer) when clicked or hovered.\r\n \t\tinteractive: false,\r\n\r\n \t\t// @option crossOrigin: Boolean|String = false\r\n \t\t// Whether the crossOrigin attribute will be added to the image.\r\n \t\t// If a String is provided, the image will have its crossOrigin attribute set to the String provided. This is needed if you want to access image pixel data.\r\n \t\t// Refer to [CORS Settings](https://developer.mozilla.org/en-US/docs/Web/HTML/CORS_settings_attributes) for valid String values.\r\n \t\tcrossOrigin: false,\r\n\r\n \t\t// @option errorOverlayUrl: String = ''\r\n \t\t// URL to the overlay image to show in place of the overlay that failed to load.\r\n \t\terrorOverlayUrl: '',\r\n\r\n \t\t// @option zIndex: Number = 1\r\n \t\t// The explicit [zIndex](https://developer.mozilla.org/docs/Web/CSS/CSS_Positioning/Understanding_z_index) of the overlay layer.\r\n \t\tzIndex: 1,\r\n\r\n \t\t// @option className: String = ''\r\n \t\t// A custom class name to assign to the image. Empty by default.\r\n \t\tclassName: ''\r\n \t},\r\n\r\n \tinitialize: function (url, bounds, options) { // (String, LatLngBounds, Object)\r\n \t\tthis._url = url;\r\n \t\tthis._bounds = toLatLngBounds(bounds);\r\n\r\n \t\tsetOptions(this, options);\r\n \t},\r\n\r\n \tonAdd: function () {\r\n \t\tif (!this._image) {\r\n \t\t\tthis._initImage();\r\n\r\n \t\t\tif (this.options.opacity < 1) {\r\n \t\t\t\tthis._updateOpacity();\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\tif (this.options.interactive) {\r\n \t\t\taddClass(this._image, 'leaflet-interactive');\r\n \t\t\tthis.addInteractiveTarget(this._image);\r\n \t\t}\r\n\r\n \t\tthis.getPane().appendChild(this._image);\r\n \t\tthis._reset();\r\n \t},\r\n\r\n \tonRemove: function () {\r\n \t\tremove(this._image);\r\n \t\tif (this.options.interactive) {\r\n \t\t\tthis.removeInteractiveTarget(this._image);\r\n \t\t}\r\n \t},\r\n\r\n \t// @method setOpacity(opacity: Number): this\r\n \t// Sets the opacity of the overlay.\r\n \tsetOpacity: function (opacity) {\r\n \t\tthis.options.opacity = opacity;\r\n\r\n \t\tif (this._image) {\r\n \t\t\tthis._updateOpacity();\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \tsetStyle: function (styleOpts) {\r\n \t\tif (styleOpts.opacity) {\r\n \t\t\tthis.setOpacity(styleOpts.opacity);\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method bringToFront(): this\r\n \t// Brings the layer to the top of all overlays.\r\n \tbringToFront: function () {\r\n \t\tif (this._map) {\r\n \t\t\ttoFront(this._image);\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method bringToBack(): this\r\n \t// Brings the layer to the bottom of all overlays.\r\n \tbringToBack: function () {\r\n \t\tif (this._map) {\r\n \t\t\ttoBack(this._image);\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method setUrl(url: String): this\r\n \t// Changes the URL of the image.\r\n \tsetUrl: function (url) {\r\n \t\tthis._url = url;\r\n\r\n \t\tif (this._image) {\r\n \t\t\tthis._image.src = url;\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method setBounds(bounds: LatLngBounds): this\r\n \t// Update the bounds that this ImageOverlay covers\r\n \tsetBounds: function (bounds) {\r\n \t\tthis._bounds = toLatLngBounds(bounds);\r\n\r\n \t\tif (this._map) {\r\n \t\t\tthis._reset();\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \tgetEvents: function () {\r\n \t\tvar events = {\r\n \t\t\tzoom: this._reset,\r\n \t\t\tviewreset: this._reset\r\n \t\t};\r\n\r\n \t\tif (this._zoomAnimated) {\r\n \t\t\tevents.zoomanim = this._animateZoom;\r\n \t\t}\r\n\r\n \t\treturn events;\r\n \t},\r\n\r\n \t// @method setZIndex(value: Number): this\r\n \t// Changes the [zIndex](#imageoverlay-zindex) of the image overlay.\r\n \tsetZIndex: function (value) {\r\n \t\tthis.options.zIndex = value;\r\n \t\tthis._updateZIndex();\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method getBounds(): LatLngBounds\r\n \t// Get the bounds that this ImageOverlay covers\r\n \tgetBounds: function () {\r\n \t\treturn this._bounds;\r\n \t},\r\n\r\n \t// @method getElement(): HTMLElement\r\n \t// Returns the instance of [`HTMLImageElement`](https://developer.mozilla.org/docs/Web/API/HTMLImageElement)\r\n \t// used by this overlay.\r\n \tgetElement: function () {\r\n \t\treturn this._image;\r\n \t},\r\n\r\n \t_initImage: function () {\r\n \t\tvar wasElementSupplied = this._url.tagName === 'IMG';\r\n \t\tvar img = this._image = wasElementSupplied ? this._url : create$1('img');\r\n\r\n \t\taddClass(img, 'leaflet-image-layer');\r\n \t\tif (this._zoomAnimated) { addClass(img, 'leaflet-zoom-animated'); }\r\n \t\tif (this.options.className) { addClass(img, this.options.className); }\r\n\r\n \t\timg.onselectstart = falseFn;\r\n \t\timg.onmousemove = falseFn;\r\n\r\n \t\t// @event load: Event\r\n \t\t// Fired when the ImageOverlay layer has loaded its image\r\n \t\timg.onload = bind(this.fire, this, 'load');\r\n \t\timg.onerror = bind(this._overlayOnError, this, 'error');\r\n\r\n \t\tif (this.options.crossOrigin || this.options.crossOrigin === '') {\r\n \t\t\timg.crossOrigin = this.options.crossOrigin === true ? '' : this.options.crossOrigin;\r\n \t\t}\r\n\r\n \t\tif (this.options.zIndex) {\r\n \t\t\tthis._updateZIndex();\r\n \t\t}\r\n\r\n \t\tif (wasElementSupplied) {\r\n \t\t\tthis._url = img.src;\r\n \t\t\treturn;\r\n \t\t}\r\n\r\n \t\timg.src = this._url;\r\n \t\timg.alt = this.options.alt;\r\n \t},\r\n\r\n \t_animateZoom: function (e) {\r\n \t\tvar scale = this._map.getZoomScale(e.zoom),\r\n \t\t offset = this._map._latLngBoundsToNewLayerBounds(this._bounds, e.zoom, e.center).min;\r\n\r\n \t\tsetTransform(this._image, offset, scale);\r\n \t},\r\n\r\n \t_reset: function () {\r\n \t\tvar image = this._image,\r\n \t\t bounds = new Bounds(\r\n \t\t this._map.latLngToLayerPoint(this._bounds.getNorthWest()),\r\n \t\t this._map.latLngToLayerPoint(this._bounds.getSouthEast())),\r\n \t\t size = bounds.getSize();\r\n\r\n \t\tsetPosition(image, bounds.min);\r\n\r\n \t\timage.style.width = size.x + 'px';\r\n \t\timage.style.height = size.y + 'px';\r\n \t},\r\n\r\n \t_updateOpacity: function () {\r\n \t\tsetOpacity(this._image, this.options.opacity);\r\n \t},\r\n\r\n \t_updateZIndex: function () {\r\n \t\tif (this._image && this.options.zIndex !== undefined && this.options.zIndex !== null) {\r\n \t\t\tthis._image.style.zIndex = this.options.zIndex;\r\n \t\t}\r\n \t},\r\n\r\n \t_overlayOnError: function () {\r\n \t\t// @event error: Event\r\n \t\t// Fired when the ImageOverlay layer fails to load its image\r\n \t\tthis.fire('error');\r\n\r\n \t\tvar errorUrl = this.options.errorOverlayUrl;\r\n \t\tif (errorUrl && this._url !== errorUrl) {\r\n \t\t\tthis._url = errorUrl;\r\n \t\t\tthis._image.src = errorUrl;\r\n \t\t}\r\n \t}\r\n });\r\n\r\n // @factory L.imageOverlay(imageUrl: String, bounds: LatLngBounds, options?: ImageOverlay options)\r\n // Instantiates an image overlay object given the URL of the image and the\r\n // geographical bounds it is tied to.\r\n var imageOverlay = function (url, bounds, options) {\r\n \treturn new ImageOverlay(url, bounds, options);\r\n };\n\n /*\r\n * @class VideoOverlay\r\n * @aka L.VideoOverlay\r\n * @inherits ImageOverlay\r\n *\r\n * Used to load and display a video player over specific bounds of the map. Extends `ImageOverlay`.\r\n *\r\n * A video overlay uses the [`